Loading...
FINAL 2023 1114 Council Agenda PacketMoses Lake City Council Don Myers, Mayor | Deanna Martinez, Deputy Mayor | Dustin Swartz, Council Member | Mark Fancher, Council Member David Eck, Council Member| Judy Madewell, Council Member| David Skaug, Council Member Tuesday, November 14, 2023 Moses Lake Civic Center – 401 S. Balsam or remote access* Regular Meeting Agenda Executive Session – 6:15 p.m. To consider the minimum price at which real estate will be offered for sale pursuant to RCW 42.30.110(1)(c) Call to Order – 6:30 p.m. Roll Call Pledge of Allegiance Approval of the Agenda Citizen’s Communications ** Summary Reports: Mayor’s Report - Veteran’s Day Proclamation - Geographic Information System (GIS) Technology Day Proclamation - Small Business Saturday Proclamation -City Manager Oath of Office Additional Business City Manager’s Report -New Employees in Community Development and Fire -Police Employee Promotion - City 2024 Legislative Agenda - pg 4 - 3rd Quarter Financial Report - pg 8 Public Hearing #1 pg 18 2024 Budget Ordinance 3038 Motion 2024 Preliminary Budget Book (updated Nov 6, 2023) Presented by Madeline Prentice, Finance Director Summary: Continue Hearing, review and consider adoption. COML Council Packet 11-14-23, Page 1 of 277 November 14, 2023, City Council Meeting Page 2 #2 Consent Agenda pg 23 Motion All items listed below are considered to be routine and will be enacted by one motion. There will be no separate discussion of these items unless a Council Member requests specific items to be removed from the Consent Agenda for discussion prior to the time Council votes on the motion to adopt the Consent Agenda. a.City Council Meeting Minutes Dated October 10, 17, and 24, 2023 b.Claims and Payroll c.Fire Impact Fee Appeal Update Ordinance 3039 d.Municipal Airport Surplus Property Resolution 3968 e.Maple Dr NE Water Main Emergency Resolution 3965 f.Grant County Health District 2024 Interlocal Agreement g.Moses Lake School District Fire Science Equipment Interlocal Agreement h.Accept Mini-Storage Water Extension Improvements Resolution 3967 i.SR-17 and Stratford Rd Pedestrian Safety Grant j.Safe Routes to Schools Nelson Road Grant k.Municipal Airport Operations Building Use Fees l.SR-17 and Yonezawa Round-a-bout Design Consultant Old Business - None scheduled New Business #3 pg 254 2024 Fee Schedule Resolution 3966 Motion Presented by Madeline Prentice, Finance Director Summary: Council to review and consider adoption Administrative Reports Council Committee Reports Adjournment Next Regular Council Meeting is scheduled for November 28, 2023 NOTICE: Individuals planning to attend the in-person meeting who require an interpreter or special assistance to accommodate physical, hearing, or other impairments, need to contact the City Clerk at (509) 764-3703 or Deputy City Clerk at (509) 764-3713 at least 24 hours in advance of the meeting. * Click this link for remote speaker request forms which must be completed by 3 p.m. on the day of the meeting for Citizen or Public Hearing Comments to be heard remotely during the live meeting. Select zoom option if signed up to speak remotely. COML Council Packet 11-14-23, Page 2 of 277 November 14, 2023, City Council Meeting Page 3 Zoom Options: web access - https://cityofml.zoom.us/j/96213777606 Or iPhone one-tap: US: +12532158782,,96213777606# or +13462487799,,96213777606# Or Telephone: Dial (for higher quality, dial a number based on your current location):US: +1 253 215 8782 or +1 346 248 7799 or +1 669 900 9128 or +1 646 558 8656 or +1 301 715 8592 or +1 312 626 6799. Webinar ID: 962 1377 7606. YouTube Live Option: https://www.youtube.com/@MosesLakeCityCouncil/streams ** In person Citizen Comment form needs to be turned in prior to start of each meeting. The 5-minute time per speaker may be reduced to allow a maximum period of 30-minutes for citizens who have signed up to speak. COML Council Packet 11-14-23, Page 3 of 277 2024 AWC Legisla�ve Priori�es 2024 COML Legisla�ve Priori�es COML Council Packet 11-14-23, Page 4 of 277 COML Council Packet 11-14-23, Page 5 of 277 Help recruit and retain police officers for public safety Provide additional funding tools and resources for officer recruitment and retention to improve public safety. This includes updating the existing local option Public Safety Sales Tax to allow implementation by councilmanic authority and greater flexibility for using the funds to cover increased officer wages and related programs like behavioral health co- response teams. Expand access to state-mandated training. In particular, continue increasing the number of classes for the Basic Law Enforcement Academy (BLEA) and expanding the new regional academies. Getting new officers on the street faster supports recruitment and retention, thus improving public safety outcomes in our communities. Revise the arbitrary property tax cap Revise the arbitrary 1% property tax cap that has been in place for more than 20 years. Tie the tax to inflation and population growth factors with a new cap not to exceed 3%. This allows local elected officials to adjust the local property tax rate to better serve our communities and keep up with the costs of providing basic services like police, fire, streets, and valued community amenities like parks. The current 1% cap has created a structural deficit in cities’ revenue and expenditure model, causing reliance on regressive revenues and artificially restricting the ability of property taxes to fund critical community needs. Continue investing in infrastructure Continue strong state investments in infrastructure funding to support operations and maintenance of traditional and non-traditional infrastructure like drinking water, wastewater, and broadband. Expand funding options that support state and local transportation needs with emphasis on preservation and maintenance to prevent expensive replacement and repairs. Improve access to Climate Commitment Act funding, including direct distributions, for city priorities that support carbon reduction and climate resiliency. Provide behavioral health resources Create greater access to behavioral health services to include substance use disorder treatment and dual diagnosis treatment facilities. Support continued state funding for cities to help communities establish alternative response programs like co-responder programs, diversion programs, and others that provide options beyond law enforcement to assist individuals experiencing behavioral health challenges. 2024 Candice Bock Government Relations Director candiceb@awcnet.org Contact: Association of Washington Cities • 1076 Franklin St SE, Olympia, WA 98501 • 1.800.562.8981 • wacities.org Strong cities make a great state. Cities are home to 65% of Washington’s residents, drive the state’s economy, and provide the most accessible form of government. Cities’ success depends on adequate resources and local decision-making authority to best meet the needs of our residents. AWC’s advocacy is guided by these core principles from our Statement of Policy: •Local decision-making authority •Fiscal flexibility and sustainability •Equal standing for cities •Diversity, equity, and inclusion •Strong Washington state partnerships •Nonpartisan analysis and decision-making City Legislative Priorities Copyright © 2023 by Association of Washington Cities, Inc. All rights reserved. | 09/26/23 Washington’s 281 cities ask the Legislature to partner with us and act on the following priorities: COML Council Packet 11-14-23, Page 6 of 277 Police Recruitment and Retention: The City of Moses Lake urges our state Legislators to provide additional funding to assist the Moses Lake Police Department with recruitment and retention of police officers. As provided by the Washington Association of Sheriffs and Police Chiefs, Washington State ranks 51st in the number of police officers per capita compared with every other state in our nation. This number is compounded by the increase in violent offense being reported state-wide and the mandate that officers responded in greater numbers to calls involving de-escalation. The City urges our state legislators to develop new funding sources for cities and counties to hire and retain new officers to keep our communities safe. Water Infrastructure: Moses Lake’s deep-water aquifer, its primary water source, has a limited life. Water conservation efforts and identification of alternative sources are underway. The Columbia Basin Project currently irrigates approximately 65 percent of the authorized acreage. To ensure an adequate supply of residential, potable water, the City of Moses Lake urges our state and federal Legislators to support the completion of the Columbia Basin Project and the Moses Lake Wellfield Superfund site cleanup. The City also urges our state Legislators to support the City’s acquisition of ground water from the Bureau of Reclamation and funding of our much needed water treatment and storage facility to meet our future water needs. Infrastructure Funding: Moses Lake has been identified as the place in the state to develop technology, as evidenced by Group 14, Sila Nanotechnologies, and STOKE Space. This requires that the City quickly ramp up infrastructure to support the new, green economy. The City will be partnering on funding requests and asks for priority consideration. The City urges state legislators to assist with funding much needed improvements to support the increased demand for industrial and residential construction in support of the technology based businesses locating in Moses Lake. The City’s immediate infrastructure needs include utility and roadway improvements to support the increased business, housing, and traffic impacts. City of Moses Lake | www.cityofml.com Kevin Fuhr, City Manager kfuhr@cityofml.com | (509) 764-3702 COML Council Packet 11-14-23, Page 7 of 277 Council Staff Report To:Agenda Item Number: From Department For Agenda of:Proceeding Type Subject Reviewed and Approved by: Expenditure Required:Amount Budgeted:Appropriation Required: Action Requested Packet Attachments (if any) Overview Fiscal and Policy Implications Approve, Authorize, or Adopt: Provide Amended Direction: No Action Taken: Kevin Fuhr, City Manager 13134 Madeline Prentice, Director Finance 11/14/2023 City Manager's Report 3rd Quarter Financial Report City Manager City Attorney Community Development Finance Fire Human Resources Parks, Rec, & Cultural Services Police Public Works Technology Services 0.00$0.00$0.00$ N/A 2023 3rd qtr financial results.pdf 297.91KB 3rd Quarter Exhibit 1.pdf 109.78KB The 2023 third quarter financial results are attached for review and consideration. N/A Options and Results N/A Staff will bring back options for recommended changes. N/A COML Council Packet 11-14-23, Page 8 of 277 MEMORANDUM To: Kevin Fuhr, City Manager From: Madeline Prentice, Finance Director Subject: 2023 3rd Quarter Budget Revenue and Expenditure Report I am pleased to submit the City of Moses Lake’s 2023 third quarter actual results compared to budgeted revenue and expenditure report for all city funds. Beginning Fund Balances shown are subject to final adjustments made as a result of the year-end closing processes, which will not be officially concluded until the State Auditor’s work is completed. Overall, the City is performing on budget in revenues while coming in under budget in expenses through the first three quarters of 2023. Variances are largely due to the timing of expenses, particularly capital expenditures, which generally catch up by year-end. Sales tax continues to increase, and as of the end of the 3rd quarter we are outpacing the budget by 20% and projected to exceed budget by October. We ended the second quarter slightly under budgeted revenues Citywide due to expected revenues for fines and penalties and capital projects. Fines and penalties will remain under budget through the end of the year due to the RedFlex red light camera program that we have not been able to resume due to issues converting from paper to electronic citations. Citywide expenses ended the third quarter under budget by 15.9% due to underspending in several funds and capital projects not anticipated to be complete until later in the year or in future years. This report is summarized by type of fund, and reported by functional type, and includes the following sections: City-Wide Overview General Fund Revenue Analysis General Fund Expenditure Analysis Other Funds Analysis Conclusion Exhibit I—Fund Detail that supports the Summaries COML Council Packet 11-14-23, Page 9 of 277 City‐Wide Overview      CITYWIDE REVENUE 2019  ACTUAL 2020  ACTUAL 2021  ACTUAL 2022  ACTUAL 2023 BUDGET 2023  ACTUAL % OF  BUDGET General Fund 25,887,624 25,951,726 30,372,088 32,221,231 31,478,080    26,925,304 85.5% Operating/Enterprise Funds 36,197,672 43,562,989 45,091,102 44,840,437 39,951,860    32,316,469 80.9% Capital Improvement Funds 7,973,837    5,841,751    17,210,514 9,052,644    22,329,852    7,665,371    34.3% Risk Mgmt/Employee Benefit 704,765  909,527   966,680   1,190,386    1,594,850  1,640,073    102.8% Debt Service Funds 2,269,748    2,268,797    3,180,950    3,122,748    3,030,252  2,280,677    75.3% TOTAL CITYWIDE REVENUES 73,033,646 78,534,790 96,821,334 90,427,447 98,384,894    70,827,894 72.0% CITYWIDE REVENUE COMPARISON AS OF: SEPTEMBER 2023 YEAR‐TO‐DATE (Budget vs Actual ‐ 75% of year) CITYWIDE EXPENDITURES 2019  ACTUAL 2020  ACTUAL 2021  ACTUAL 2022  ACTUAL 2023 BUDGET 2023  ACTUAL % OF  BUDGET General Fund 25,580,122 26,845,963 28,337,019 29,332,923 35,582,928    26,336,131 74.0% Operating/Enterprise Funds 36,266,759 39,822,798 38,376,182 40,019,271 48,674,423    31,067,097 63.8% Capital Improvement Funds 6,734,114    7,306,373    9,180,367    16,710,922 26,491,475    6,755,286    25.5% Risk Mgmt/Employee Benefit 837,344  989,361   887,335   1,180,704    1,652,039  1,647,215    99.7% Debt Service Funds 643,388  2,188,792    2,640,520    2,659,083    3,030,152  2,365,340    78.1% TOTAL CITYWIDE EXPENDITURES 70,061,727 77,153,286 79,421,422 89,902,903 115,431,017 68,171,070 59.1% CITYWIDE EXPENSE COMPARISON AS OF: SEPTEMBER 2023 YEAR‐TO‐DATE (Budget vs Actual ‐ 75% of year) COML Council Packet 11-14-23, Page 10 of 277 General Fund Revenue Analysis  Property Tax – The budget was set based on assumptions of new construction and collection rates, and then discounted for collection delinquencies. The third quarter results include the first half collections of Property Tax assessments. The second half of property tax assessments is not received by the City until November and will be reported on the 4th quarter results after the beginning of the new year. Sales Tax – Actual sales tax at the end of the third quarter exceeds budgeted sales tax by 20% and is 10.4% higher than the 3rd quarter in 2022 to end the quarter at $8.74 million. We anticipate sales tax to remain strong through the end of the year and exceed budget. Sales Tax-Public Safety - This represents the 0.3% Criminal Justice Tax. As with Sales Tax, public safety sales tax continues to be strong with collections through the third quarter being 21.4% higher than budget at $1.49 million and $287k (23.8%) ahead of 3rd quarter 2022. Utility Tax – This revenue source experiences fluctuations either from rate adjustments or seasonal usage. Through the third quarter, we are 3.1% higher than budget at $2.87 million and 8.3% higher than the same period in 2022. Increases were seen in all utility taxes except telephone (landline) utility taxes. The increases in all other utility taxes more than offset the telephone tax decrease. 2019  ACTUAL 2020  ACTUAL 2021  ACTUAL 2022  ACTUAL 2023 BUDGET 2023  ACTUAL % OF  BUDGET 310 ‐ Taxes Property Tax 7,425,811    7,808,702    7,899,047    8,482,243    8,821,500  5,600,236    63.5% Sales Tax 7,216,489    7,509,197    9,721,190    10,718,921 9,200,000  8,736,623    95.0% Sales Tax ‐ Public Safety ‐   982,158   1,416,209    1,679,634    1,550,000  1,493,795    96.4% Utility Tax 3,364,293    3,282,678    3,550,168    3,643,809    3,681,000  2,873,041    78.1% Gambling Tax 263,173  130,769   203,027   229,656   206,000    177,685   86.3% Other Taxes 89,026   34,306     42,359    64,778    49,000  58,602    119.6% Subtotal‐Taxes 18,358,793 19,747,809 22,831,999 24,819,040 23,507,500    18,939,983 80.6% 320 ‐ Licenses & Permits 727,066  920,713   1,149,294    738,177   894,000    1,451,813    162.4% 330 ‐ Intergovernmental Revenues 890,364  1,988,660    1,466,318    1,403,463    1,538,995  904,104   58.7% 340 ‐ Charges for Goods & Services 1,856,315    798,633   1,953,769    2,479,923    2,493,360  2,526,988    101.3% 350 ‐ Fines and Penalties 937,086  643,672   1,030,324    896,415   978,000    171,939   17.6% 360 ‐ Miscellaneous Revenues 680,995  322,820   206,258   276,973   360,150    1,999,517    555.2% 390 ‐ Other Financing Resources ‐   59,863     233,774   2,285  1,500  ‐   0.0% TOTAL GENERAL FUND REVENUES 23,450,619 24,482,170 28,871,737 30,616,277 29,773,505    25,994,344 87.3% Other General Fund ‐ Sources Cost Allocations 1,885,308    969,556   1,000,351    1,011,565    1,179,575  866,835   73.5% Transfers In 551,697  500,000   500,000   593,389   525,000    64,125    12.2% TOTAL GENERAL FUND REVENUES 25,887,624 25,951,726 30,372,088 32,221,231 31,478,080    26,925,304 85.5% YEAR‐TO‐DATE CITY OF MOSES LAKE GENERAL FUND REVENUES AS OF: SEPTEMBER 2023 (Budget vs Actual ‐ 75% of year) COML Council Packet 11-14-23, Page 11 of 277 Gambling Taxes - Revenues through the third quarter of the year exceeded budget by 11.3% at $177.7k and are 1.1% higher than the same period in 2022. Other Taxes—This consists of Leasehold Excise Tax and Admissions Tax. Through the second quarter, Leasehold Excise tax is 4.4% higher than the same period in 2022 and 2.3% ahead of budget. Admissions Tax remains strong and ended the third quarter at $40.1k or 60.2% ahead of budget and ahead of the same period in 2022 by 20.6%. Licenses and Permits – The majority of this revenue is generated by the development community and is difficult to budget because it is volatile by nature. 2023 third quarter results are at 162.4% of budget to end the third quarter at $1.45 million and ahead of the same period in 2022 by $933k or 179.8%. Intergovernmental Revenue – This category includes State-shared revenue, the PUD privilege tax, Criminal Justice funding and other grants. Through the third quarter, we are below budget and behind the same period in 2022 by 16.3% to end the third quarter at $904k. This is largely due to a decrease in state shared revenue payments in addition to not yet receiving reimbursement on grants awarded in 2023. Charges for Goods and Services primarily consist of: Fees charged for Parks and Recreation Programs, Zoning, subdivision, plan check and annexation fees, School Resource Officers (SRO’s) reimbursed by Moses Lake School District, and; Fire protective inspection fees and other fire reimbursements The bulk of the fees charged for Parks and Recreation programs are received in the 3rd quarter of the year. Parks, Recreation & Museum activity, and programming fees for the third quarter are up over 2022, exceeding 2022 revenues by $156k or 12.03% largely due to the opening of the Larson Recreation Center but are under budget by 6.0% at the end of the third quarter. Zoning, subdivision, and plan check fees are up by 23.8% over the same period in 2022. SRO and Fire reimbursement fees are up 20.2% and 10.2% respectively over 2022. Overall, charges for goods and services are up 26.3% over budget through the third quarter to end the period at $2.5 million and 14.2% over the same period in 2022. Fines and Penalties consist almost entirely of fines generated by the red-light camera program. Changing from paper to electronic citations earlier this year, resulted in minimal citations being submitted/processed. The issues have not yet been resolved and we do not anticipate receipting revenues through the remainder of the year as the County continues to work on the problems with the electronic citations. Miscellaneous Revenues include interest earnings on investments and facility rentals. Interest earnings are significantly higher than budgeted, leading to Miscellaneous Revenues coming in at COML Council Packet 11-14-23, Page 12 of 277 $2.0 million through the third quarter. Facility rentals are up 11.2% from the same time last year, and above budget by 13.9%. Other Financing Resources is made up primarily of the City Administrative fee charged to funds for services provided by the executive branch and finance and does not get charged until the end of the year. Summary --Overall, through the first half of the year, General Fund revenue is exceeding budget by 10.5% to end the period at $26.9 million and is ahead of the same period in 2022 by $4.36 million or 19.3%. General Fund Expenditure Analysis  The General Fund Expenditures through the third quarter are slightly under budget at 74.0% but ahead of the same period in 2022 by 16.3%. This increase consists primarily of salaries/benefits as well as increases in supplies and professional services costs. Since General Fund is 60% staffing, events affecting total payroll have a significant impact on budgets. Position vacancies may start out being an “overage” because of the cashout of earned accrued leave balances, but then can produce savings when the position is vacant for any length of time. Most variances in individual divisions are the result of increased staffing, overtime, payout of accrued leave balances, or increased professional services. The Executive budget is 18.0% over budget, due to the payout of accrued leave balances and moving the Public Information Officer position from Parks & Recreation to the Executive Department in the third quarter. GENERAL FUND EXPENDITURES 2019  ACTUAL 2020  ACTUAL 2021  ACTUAL 2022  ACTUAL 2023 BUDGET 2023  ACTUAL % OF  BUDGET Legislative 348,327  357,490   265,880   148,732   156,124    119,794   76.7% Executive 938,597  865,604   634,221   559,532   851,546    792,875   93.1% Human Resources 301,375  192,726   339,757   529,075   547,837    446,781   81.6% Finance 1,090,564    1,203,967    1,193,074    1,072,445    1,312,410  842,974   64.2% Community Development 1,411,301    1,640,960    1,734,463    1,941,178    2,710,383  1,674,920    61.8% Legal 208,641  211,192   195,236   203,049   278,730    159,756   57.3% Misc. Services 1,804,832    2,340,491    1,924,954    1,975,753    2,181,225  1,662,124    76.2% Library 78,976   78,269     63,526    68,543    64,500  45,474    70.5% Engineering 2,055,148    2,210,430    1,748,970    1,894,674    2,603,148  1,729,703    66.4% Parks, Rec & Cultural Services 5,874,843    5,161,426    6,639,091    6,963,360    7,579,846  5,639,697    74.4% Police 7,647,601    8,296,331    9,249,322    9,751,781    11,444,946    8,977,448    78.4% Fire 3,819,916    4,287,077    4,348,525    4,224,799    5,852,235  4,244,585    72.5% TOTAL GENERAL FUND EXPENDITURES 25,580,122 26,845,963 28,337,019 29,332,923 35,582,928    26,336,131 74.0% CITY OF MOSES LAKE GENERAL FUND EXPENDITURES AS OF: SEPTEMBER 2023 YEAR‐TO‐DATE (Budget vs Actual ‐ 75% of year) COML Council Packet 11-14-23, Page 13 of 277 The Human Resources budget is 6.6% over budget due to professional service costs for the labor attorney in negotiating contracts and grievances, temporary pay for a summer intern, and computer software costs that were not included in the original budget. All other General Fund budgets are at varying levels compared to the budget. Conclusion—General Fund at the end of the second quarter is slightly under budget at 74.0% of adopted budget in expenditures. Sales Tax, Public Safety Tax, Utility tax, Licenses and Permits, and Charges for Goods & Services more than offset revenues that are more unpredictable and cyclical in nature. As of the end of September, general fund reserves increased by $518,346.   Other Funds Analysis    Variances in capital funds are related to timing of major projects, as well as capital components in operating funds (such as Building Maintenance, Fleet Maintenance, Central Services and Stormwater capital projects/purchases). Debt Service funds primarily only have interest payments due in the first half of the year—principal payments are typically scheduled for later in the year so the fund can build up the necessary balance. Property and liability insurance premiums are due at the first of the year, so the Risk Management fund is overspent during the year and corrects by the end of the year. At the end of the third quarter, hotel/motel tax revenues have already exceeded budget at $775k or 39.0% and 23.3% above the third quarter of 2022. Expenditures continue to be below budget, but most expenses are paid out later in the year. OTHER FUNDS REVENUES 2019  ACTUAL 2020  ACTUAL 2021  ACTUAL 2022  ACTUAL 2023 BUDGET 2023  ACTUAL % OF  BUDGET Operating/Enterprise Funds 36,197,672 43,562,989 45,091,102 44,840,437 39,951,860    32,316,469 80.9% Capital Improvement Funds 7,973,837    5,841,751    17,210,514 9,052,644    22,329,852    7,665,371    34.3% Risk Mgmt/Employee Benefit 704,765  909,527   966,680   1,190,386    1,594,850  1,640,073    102.8% Debt Service Funds 2,269,748    2,268,797    3,180,950    3,122,748    3,030,252  2,280,677    75.3% TOTAL OTHER FUNDS REVENUES 47,146,022 52,583,064 66,449,246 58,206,216 66,906,814    43,902,590 65.6% OTHER FUNDS EXPENDITURES 2019  ACTUAL 2020  ACTUAL 2021  ACTUAL 2022  ACTUAL 2023 BUDGET 2023  ACTUAL % OF  BUDGET Operating/Enterprise Funds 36,266,759 39,822,798 38,376,182 40,019,271 48,674,423    31,067,097 63.8% Capital Improvement Funds 6,734,114    7,306,373    9,180,367    16,710,922 26,491,475    6,755,286    25.5% Risk Mgmt/Employee Benefit 837,344  989,361   887,335   1,180,704    1,652,039  1,647,215    99.7% Debt Service Funds 643,388  2,188,792    2,640,520    2,659,083    3,030,152  2,365,340    78.1% TOTAL OTHER FUNDS EXPENDITURES 44,481,605 50,307,323 51,084,404 60,569,980 79,848,089    41,834,939 52.4% YEAR‐TO‐DATE OTHER FUNDS REVENUES AND  EXPENDITURES AS OF: SEPTEMBER 2023 (Budget vs Actual ‐ 75% of year) YEAR‐TO‐DATE COML Council Packet 11-14-23, Page 14 of 277 Homeless Services is under budget in both revenues and expenses due to timing of requesting reimbursement on the grants and invoices received for payment. Additionally, as the Homeless shelter location continues to be discussed/reviewed, the ARPA funds allocated for the project have not been spent. Water/Wastewater Fund revenues typically increase during the hotter months, as more water is used for irrigating. Revenues for the third quarter are 10.9% higher than budget and 8.6% higher than third quarter 2022. Expenditures are under budget at 60.0% through the third quarter of the year. The Sanitation Fund is 10.9% above budget in revenues, ending the quarter at $4.4 million. Expenses are under budget by 3.2% at the end of the third quarter. Stormwater is under budget in both revenues (6.6%) and expenses (12.9%) through the third quarter. Revenues are largely under budget due to grant revenue that has not yet been received while expenses are under budget due to anticipated professional services that have not been paid yet. The Ambulance fund is slightly above budget in revenues at 78.3% ($3.1 million), and over budget in expenses (88.8%, $3.4 million) due to increased salaries/benefits (retro pay from 2022) and overtime costs. Finance is reviewing the Ambulance and Fire budgets to ensure staff were budgeted in the correct fund and will adjust as necessary. Equipment Rental/Fleet Maintenance is at 84.2% in revenue due to insurance recoveries and sales of surplus vehicles. Expenses are over budget due to capital purchases ordered in 2022 that were not received until early 2023 and the expense not carried forward into the 2023 budget. We are evaluating the budget and will bring a budget amendment to Council for consideration prior to the end of the year. Conclusion  Overall, 2023 Citywide results through the third quarter are essentially on or under budget. Third quarter revenues ended at $70.8 million or 72.0%, slightly below budget but 14.2% or $8.8 million ahead of same period in 2022. Citywide expenses are under budget by 15.9% ending the third quarter at $68.17 million, and ahead of the third quarter of 2022 by 5.6% or $3.6 million, largely due to increases in wages, benefits, supplies, and services. All funds have positive fund balances at the end of the third quarter with a net gain in the Citywide fund balance of $2.1 million. COML Council Packet 11-14-23, Page 15 of 277 Exhibit 1BEG. FUND BAL.1/1/20232022 Actual Revenues2023 Amended Budget2023 Actual Revenues% Received2022 Actual Expenditures2023 Amended Budget2023 Actual Expenses% Expended2023 (Use) Gain of Fund Balance 9/30/2023GENERAL FUNDLegislative148,732 156,124 119,794 76.7%Executive559,532 851,546 792,875 93.1%Human Resources529,075 547,837 446,781 81.6%Finance1,072,445 1,312,410 842,974 64.2%Community Development1,941,178 2,710,383 1,674,920 61.8%Legal203,049 278,730 159,756 57.3%Misc. Services1,975,753 2,181,225 1,662,124 76.2%Library68,543 64,500 45,474 70.5%Engineering1,894,674 2,603,148 1,729,703 66.4%Parks, Rec & Cultural Services6,963,360 7,579,846 5,639,697 74.4%Police9,751,781 11,444,946 8,977,448 78.4%Fire4,224,799 5,852,235 4,244,585 72.5%TOTAL GENERAL FUND8,803,536$ 32,221,231$ 31,478,080$ 26,925,304$ 85.5%29,332,923$ 35,582,928$ 26,336,131$ 74.0% 518,346$ 9,321,882$ OTHER OPERATING/ENTERPRISE FUNDSTourism Activities -1021,251,662 1,173,625 680,000 775,148 114.0%779,399 766,769 454,868 59.3% 310,596 1,562,257 Grants & Donations -1031,104,116 277,769 105,345 192,026 182.3%196,318 108,000 106,336 98.5% 80,969 1,185,085 Local Fiscal Recovery -1056,215,015 3,365,998 - - 0.0%516,046 6,291,000 2,502,564 39.8% (2,502,564) 3,712,452 Homeless Services -110438,528 914,151 2,387,522 767,887 32.2%847,444 2,338,663 409,846 17.5% 245,106 683,634 Opioid Abatement - 11133,296 33,296 - 17,062 0.0%- - - 0.0% 17,062 50,358 Paths & Trails - 114104,099 11,881 12,000 11,682 97.4%996 27,000 - 0.0% 11,682 115,781 Streets - 116846,457 1,957,396 1,976,614 1,623,001 82.1%2,214,768 2,742,398 1,758,037 64.1% (194,358) 652,099 Transportation Benefit District - 170944,220 2,575,826 2,176,000 2,034,668 93.5%2,154,000 2,175,000 1,631,250 75.0% 403,418 1,347,638 Water/Wastewater Operating - 411/4125,355,884 15,665,689 14,333,260 12,309,508 85.9%15,581,698 15,789,421 9,477,048 60.0% 2,114,253 7,470,137 Sanitation -4901,629,733 5,883,567 5,125,000 4,401,977 85.9%5,465,800 4,971,700 3,568,913 71.8% 354,639 1,984,372 Stormwater - 493725,632 1,171,689 1,465,304 1,002,738 68.4%843,443 1,348,807 838,222 62.1% 174,873 900,506 Airport - 49599,486 205,079 41,000 31,569 77.0%197,340 106,852 61,367 57.4% (28,056) 71,430 Ambulance - 498627,283 3,906,650 3,989,083 3,125,166 78.3%3,800,043 3,853,721 3,421,389 88.8% (305,833) 321,450 Central Svc - 517728,350 2,179,791 2,671,660 2,003,760 75.0%1,936,763 2,847,586 1,950,297 68.5% 114,125 842,475 Equipment Rental -5192,717,707 2,901,703 2,994,612 2,521,816 84.2%3,689,340 3,296,008 3,225,076 97.8% (846,901) 1,870,806 Build Maint -5282,164,189 2,616,325 1,994,460 1,498,462 75.1%1,795,874 2,011,499 1,661,884 82.6% (89,222) 2,074,967 TOTAL OTHER OPERATING/ENTERPRISE24,985,657$ 44,840,437$ 39,951,860$ 32,316,469$ 80.9%40,019,271$ 48,674,423$ 31,067,097$ 63.8% (140,211)$ 24,845,446$ CITY OF MOSES LAKE2023 FUND SUMMARYAS OF: SEPTEMBER 2023REVENUESEXPENDITURESEND. FUND BAL.1COML Council Packet 11-14-23, Page 16 of 277 Exhibit 1BEG. FUND BAL.1/1/20232022 Actual Revenues2023 Amended Budget2023 Actual Revenues% Received2022 Actual Expenditures2023 Amended Budget2023 Actual Expenses% Expended2023 (Use) Gain of Fund Balance 9/30/2023CITY OF MOSES LAKE2023 FUND SUMMARYAS OF: SEPTEMBER 2023REVENUESEXPENDITURESEND. FUND BAL.CAPITAL IMPROVEMENTStreet Repair/Reconst -119 1,361,426 4,092,759 3,359,852 2,590,709 77.1% 6,754,585 3,700,000 1,060,167 28.7% 1,567,481 2,928,907 Parks & Recreation Improvement - 314 880,727 124,255 - - 0.0%6,893,122 10,216 123,490 1208.8% (292,238) 588,488 Park Mitigation Capital Proj - 31535,703 2,071 - 3,295 0.0%- - - 0.0% 3,295 38,997 Community Services Center - 316- - 15,000,000 - 0.0%- 15,000,000 - 0.0%- - Fire Mitigation Fund - 320- - - 339,934 0.0%- -- 0.0% 339,934 339,934 Water/Well Remediation - 322- - - 2,000,000 0.0%- -52,178 0.0% 1,971,581 1,971,581 Water Rights - 4712,013,521 933,560 800,000 353,939 44.2%- 1,030,000 815,243 79.1% (459,834) 1,553,688 Water/Sewer Construction - 4775,605,824 3,900,000 3,170,000 2,377,494 75.0%3,063,215 6,751,259 4,704,208 69.7% (2,508,255) 3,097,569 TOTAL CAPITAL IMPROVEMENT9,897,200$ 9,052,644$ 22,329,852$ 7,665,371$ 34.3%16,710,922$ 26,491,475$ 6,755,286$ 25.5% 621,964$ 10,519,164$ RISK MGMT/EMPLOYEE BENEFIT RESERVESUnemployment Compensation - 50161,637 106,999 85,100 63,747 74.9%85,788 74,000 30,332 41.0% 21,839 83,475 Risk Management -503383,045 1,012,000 1,454,250 1,522,650 104.7%1,060,118 1,523,039 1,599,010 105.0% (88,816) 294,229 Firemen's Relief & Pension - 611400,124 71,388 55,500 53,676 96.7%34,799 55,000 17,873 32.5% 35,803 435,927 TOTAL RISK MGMT/EMPL BENEFIT RSVS844,805$ 1,190,386$ 1,594,850$ 1,640,073$ 102.8%1,180,704$ 1,652,039$ 1,647,215$ 99.7% (31,174)$ 813,631$ DEBT SERVICELOCAL Borrowing 21/22 - 282976,889 1,452,500 1,354,652 1,023,971 75.6%989,824 1,354,652 690,040 50.9% 333,930 1,310,819 GOB 2016 Refunding-286184,768 375,900 376,200 282,150 75.0%375,729 376,200 375,958 99.9% (93,683) 91,084 Water-Sewer 2011 Bond-45010,304 - - - 0.0%- - - 0.0%- 10,304 Bond Reserve-2011 451567,600 - - - 0.0%- - - 0.0%- 567,600 Water-Sewer 2004 Bond-452- 686,248 1,224,000 918,000 75.0%686,325 1,224,000 1,224,150 100.0% 918,000 918,000 Water-Sewer 2004 Bond Reserve-453701,500 - - - 0.0%- - - 0.0%- 701,500 PWTF W/S Debt Serv - 48520,196 532,100 - - 0.0%532,059 - - 0.0%- 20,196 2015 GO Bond Redempt- 4879,313 76,000 75,400 56,556 75.0%75,146 75,300 75,192 99.9%241 9,555 TOTAL DEBT SERVICE2,470,571$ 3,122,748$ 3,030,252$ 2,280,677$ 75.3%2,659,083$ 3,030,152$ 2,365,340$ 78.1% 1,158,488$ 3,629,059$ TOTAL CITY BUDGET47,001,768$ 90,427,447$ 98,384,894$ 70,827,894$ 72.0%89,902,903$ 115,431,017$ 68,171,070$ 59.1% 2,127,414$ 49,129,182$ 2COML Council Packet 11-14-23, Page 17 of 277 Council Staff Report To:Agenda Item Number: From Department For Agenda of:Proceeding Type Subject Reviewed and Approved by: Expenditure Required:Amount Budgeted:Appropriation Required: Action Requested Packet Attachments (if any) Kevin Fuhr, Interim City Manager 12986 Madeline Prentice, Director Finance 11/14/2023 Public Hearing 2024 Budget Ordinance City Manager City Attorney Community Development Finance Fire Human Resources Municipal Services Parks, Rec, & Cultural Services Police Technology Services 0.00$0.00$0.00$ Conduct the Public Hearing, then adopt the budget ordinance. 0 - 2024 Final Budget.pdf 3.44MB 2024 Budget Ordinance.docx 24.37KB 3a - Schedule A.pdf 106.86KB COML Council Packet 11-14-23, Page 18 of 277 Overview Fiscal and Policy Implications Approve, Authorize, or Adopt: Provide Amended Direction: No Action Taken: The Annual Budget provides for the financial planning, control, and evaluation of all funds. Prior to Council presentation, the City Manager, Finance Director, and Department Directors met to review budget proposals. The City Manager made recommendations to create the proposed budget that was presented to City Council in a work session on September 23, 2023. City Council provided guidance and direction for budget reductions which were incorporated into a revised budget proposal which was presented to City Council at a second work session held on October 17th. Council conducted the first public hearing on the 2024 Preliminary Budget on October 24, 2023. From that meeting, no further recommendations from Council were made. When the second public hearing is completed on November 14, 2023, Council could pass the ordinance. For the Final Budget, all funds are balanced within available resources (i.e. reserves and new revenues). Additional explanation and summaries of revenues and expenditures by fund are included in a separate 2024 Final Budget document which is available for public review on the City of Moses Lake website. This is the presentation of the budget ordinance establishing the authorization and spending plan for the 2024 fiscal year for all City operations. It requires a hearing to accept public comments and input. A balanced budget needs to be adopted by December 31, 2023. The budget includes revenue estimates based on the 2024 Fee Schedule which will be presented to Council in a separate agenda item also on November 14, 2023. The final budget also includes the 2024 pay scale for non-represented staff which we are recommending adoption of by Council with the final 2024 budget adoption. Adoption of the 2024 salary schedule shown in the appendix to the budget supports the salaries and wages included in the 2024 annual budget. The total proposed 2024 expenditure budget is approximately $105.5 million with the General Fund operating budget amounting to $40.2 million. All funds are balanced within available resources. One change was made to the budget from the first public hearing held on October 24, 2023. The Transportation Benefit District Fund (#170) did not include the correct transfer amount to the Streets Maintenance Fund (#116) that is necessary in 2024. In the Proposed budget the transfer amount to Streets Maintenance (Fund 116) was listed as $500,000. However, upon further review, it was discovered that Streets Maintenance requires a transfer from the Transportation Benefit District (Fund 170) in the amount of $600,000. This correction has been made to the 2024 Final Budget resulting in an additional $100,000 of expense in the Other Operating/Enterprise Funds and increasing the total 2024 budgeted expenditures to $105.6 million. No other changes were made and all funds remain balanced within available resources. Options and Results Staff recommends City Council conduct the Public Hearing, then adopt the budget ordinance. Continue the Public Hearing, consider adoption of the budget. The budget process continues in compliance with state law. Provide staff with specific changes, which would then need to be incorporated into the budget to be brought back for adoption at the November 28, 2023 meeting. COML Council Packet 11-14-23, Page 19 of 277 ORDINANCE NO. 3038 AN ORDINANCE ADOPTING THE BUDGET FOR THE CITY OF MOSES LAKE, WASHINGTON FOR THE YEAR 2024 AND MAKING APPROPRIATIONS FOR ESTIMATED EXPENDITURES WHEREAS, on or before the 24th day of October 2023, a proposed budget and estimate of the amount of moneys required to meet the public expenses, and retirement and interest, reserve funds, and expenses of government of the City for the year 2024 was duly filed with the City Clerk of the City of Moses Lake and submitted to the City of Moses Lake City Council, all in accordance with applicable laws, and WHEREAS, subsequent to October 24, 2023, the City Council held hearings on the budget and on October 24 and November 14, 2023, the City Council held formal public hearings on the budget all in accordance with applicable laws, and WHEREAS, subsequent to its formal public hearings, the City Council made adjustments and changes to the budget as the Council deemed necessary or proper and determined the allowance in each item, department, classification and fund, all as set forth in the final budget document attached hereto, all in accordance with applicable laws, and WHEREAS, the proposed budget does not exceed the lawful limit of taxation allowed by law to be levied on the property within the City for the purposes set forth in the budget, and the estimated expenditures set forth in the budget being all necessary to carry on the government of the City for fiscal year 2024 and being sufficient to meet the various needs of the City during that period; now, therefore, THE CITY COUNCIL OF THE CITY OF MOSES LAKE, WASHINGTON DO ORDAIN AS FOLLOWS: Section 1. The budget for the City of Moses Lake, Washington for the year 2024 is hereby adopted at the fund level in its final form and content as set forth in the budget document, “City of Moses Lake, Annual Budget-2024”, which is attached hereto as Schedule A. Section 2. Estimated resources for each separate fund of the City of Moses Lake, and aggregate expenditures for all such funds for the year 2024 are set forth in summary form entitled “City of Moses Lake, Annual Budget – 2024” which is attached hereto as Schedule A and are hereby appropriated for expenditure at the fund level during the year 2024. Pursuant to RCW 35A.13.080 the City Manager shall administer the expenditure of all funds appropriated herein, and the City Manager is authorized to take all necessary and prudent actions to implement the City Council’s expenditure directives and budget appropriations. Section 3. The budget for the 2024 fiscal year is inclusive of the 2024 fee schedule as approved and accepted by Council by separate resolution. COML Council Packet 11-14-23, Page 20 of 277 Section 4. The Clerk for City Council is directed to transmit a certified copy of the budget hereby adopted to the Division of Municipal Corporations in the Office of the State Auditor and to the Association of Washington Cities. Section 5. This ordinance shall take effect and be in force five (5) days after its passage and publication of its summary as provided by law. Passed by the City Council and signed by its Mayor on November 14, 2023. ______________________________________ Don Myers, Mayor ATTEST: ________________________________ Debbie Burke, City Clerk APPROVED AS TO FORM: __________________________________ Katherine L. Kenison, City Attorney Martinez Swartz Myers Fancher Madewell Eck Skaug Vote: Date Published: November 20, 2023 Date Effective: November 25, 2023 COML Council Packet 11-14-23, Page 21 of 277 Fund Description 2024 Annual  Revenues 2024 Gain/(Use)  of Fund Balance 2024 Expenditure  Appropriation % of Budget 001 General Fund 35,652,726$        (4,552,187)$          40,204,913$             38.1% 102 Tourism Activities 800,000$              (114,050)$             914,050$                   0.9% 103 Grants & Donations 246,244$              8,744$                   237,500$                   0.2% 105 Local Fiscal Recovery ‐$                       (3,316,520)$          3,316,520$                3.1% 110 Homeless Services 2,698,302$           (164,576)$             2,862,878$                2.7% 111 Opioid Abatement 17,062$                17,062$                ‐$                            0.0% 112 Public Arts Program 100,000$              70,000$                30,000$                     0.0% 114 Paths & Trails 12,000$                1,000$                   11,000$                     0.0% 116 Streets 3,080,070$           (219,320)$             3,299,390$                3.1% 170 Transportation Benefit District 2,500,000$           ‐$                       2,500,000$                2.4% 410 Water/Wastewater Operating 16,832,687$        615,701$              16,216,986$             15.4% 490 Sanitation 5,125,000$           (247,800)$             5,372,800$                5.1% 493 Stormwater 1,673,547$           (110,685)$             1,784,232$                1.7% 495 Airport 69,834$                (8,817)$                 78,650$                     0.1% 498 Ambulance 4,555,500$           24,187$                4,531,313$                4.3% 517 Central Services 1,920,810$           50,801$                1,870,009$                1.8% 519 Equipment Repair & Rental 3,691,960$           766,487$              2,925,473$                2.8% 528 Build Maintenance 3,290,698$           (791,534)$             4,082,232$                3.9% 119 Street Repair/Reconst 4,250,549$           699,384$              3,551,165$                3.4% 314 Parks & Recreation Improvement 258,000$              (11,400)$               269,400$                   0.3% 315 Park Mitigation Capital Projects ‐$                       ‐$                       ‐$                            0.0% 316 Community Services Center 525,000$              9,901$                   515,099$                   0.5% 320 Fire Mitigation Fund ‐$                       ‐$                       ‐$                            0.0% 322 Water/Well Remediation 500,000$              (512,000)$             1,012,000$                1.0% 471 Water Rights 500,000$              (250,000)$             750,000$                   0.7% 477 Water/Sewer Construction 4,300,000$           25,469$                4,274,531$                4.0% 501 Unemployment Compensation 144,000$              54,000$                90,000$                     0.1% 503 Risk Management 2,165,000$           2,798$                   2,162,203$                2.0% 611 Firemen's Relief & Pension 54,000$                19,000$                35,000$                     0.0% 282 LOCAL Borrowing 21/22 994,573$              ‐$                       994,573$                   0.9% 286 GOB 2016 Refunding 380,000$              33$                        379,967$                   0.4% 452 Water‐Sewer 2004 Bond 1,228,500$           ‐$                       1,228,500$                1.2% 487 2015 GO Bond Redempt 76,000$                ‐$                       76,000$                     0.1% 97,642,061$        (7,934,323)$         105,576,384$            City of Moses Lake, Washington Annual Budget ‐ 2024 Schedule A Summary of Available Resources and Appropriations by Fund COML Council Packet 11-14-23, Page 22 of 277 MOSES LAKE CITY COUNCIL October 10, 2023 STUDY SESSION HopeSource Service Statistics Brittany Bouchouari, Director of Operations presented a slide deck on the core programs, services, shelter statistics, expenses, sleep center needs, operation costs and success stories. There was also a Council Q & A regarding outreach, shelter rules, partnerships with Renew, WorkSource, etc., discussion of grants and donations and the client to advocate ratio. CALL TO ORDER The regular meeting of the Moses Lake City Council was called to order at 6:30 p.m. by Mayor Myers in the Council Chambers of the Civic Center with audio remote access. Special notice for remote attendance and citizen comment were posted on the meeting agenda. ROLL CALL Present: Mayor Myers; Deputy Mayor Martinez; Council Members Fancher, Madewell, Swartz, and Skaug. Council Member Eck was absent. Action taken: Council Member Fancher moved to excuse Council Member Eck, second by Deputy Mayor Martinez. The motion carried 6 – 0. PLEDGE OF ALLEGIANCE Girl Scouts Troop 1232 led the Flag Salute. AGENDA APPROVAL Action taken: Council Member Fancher moved to approve the Agenda as presented, second by Council Member Swartz. The motion carried 6 – 0. CITIZEN’S COMMUNICATION Vouchers and Projects Victor Lombardi, Moses Lake, requested information on Summit Law, McKinstry, and Rolluda Architects expenses; and to have any current lawsuits itemized. He suggested staff post the status of projects online. Staff and Council responded that there will be a page launched soon for projects. Marina Drive Linda Curran, Moses Lake, let Council know that signs are posing a hazard for seeing traffic in the area of Marina Drive and Broadway Ave. Miscellaneous Elisia Dalluge, Moses Lake, requested Council approve the Fire Impact Fee and the BMX track improvements, gave kudos to the fire department for fire prevention week activities, discussed lake clean-up and HopeSource services. COML Council Packet 11-14-23, Page 23 of 277 CITY COUNCIL MINUTES – October 10, 2023 pg. 2 SUMMARY REPORTS MAYOR’S REPORT Girl Scouts “Day of the Girl” Presentation Three members of Girl Scouts Troop 1232 provided a presentation about the International ‘Day of the Girl’ occurring on October 11 to recognize empowerment of young ladies to dream big and reach their full potential for human rights. Planning Month Proclamation Mayor Myers read the Planning Month Proclamation declaring October as National Community Planning Month. Hispanic Heritage Month Proclamation A proclamation declaring September 15 through October 15 as Hispanic Heritage Month was read by Deputy Mayor Martinez. CITY MANAGER’S REPORT Employee Introductions from Fire and Police New Fire Marshal Jeff Vander Giessen, and the new Fire Fighters that are funded by the SAFER Grant were introduced: Shawn Scott, Darrin Jacobs, Christopher Gonzales Rice, Zachary Feist, William Ellis, Justin Dominguez, Joshua Bollinger, and Nathan Aamold. Police introduced the new Criminal Analyst, Levi Giraud. AWC Legislative Agenda Interim City Manager Fuhr provided Council with a copy of the 2024 AWC Legislative Agenda and the 2023 City of Moses Legislative Agenda at the meeting. He requested Council send him requests for the 2024 local legislative agenda to be reviewed and considered for adoption at a future meeting. PUBLIC HEARING #1 Windrose Dr. Right-of-Way Vacation Ordinance 3036 Schneider Homes is requesting to vacate a portion of the cul-de-sac to reconfigure it into a normal appearing "T" intersection in the Polo Ridge 4 Plat. The hearing opened at 7:09 p.m. There was no testimony, and the hearing was closed. Action taken: Council Member Fancher moved to adopt Ordinance 3036 as presented, second by Council Member Swartz. The motion carried 6 – 0. CONSENT AGENDA #2 a. City Council Meeting Minutes Dated September 21 and 23, 2023 b. Electronic Transfer: N/A Checks: 162424 - 162630 - $593,737.83 Payroll Checks: 09-29-2023 PR, #65908 - 65922 - $13,183.29 Electronic Payments: 09-29-2023 Direct Deposit: - $602,208.87 COML Council Packet 11-14-23, Page 24 of 277 CITY COUNCIL MINUTES – October 10, 2023 pg. 3 c. 2024 Snowplow Contract Award d. Award Wastewater Valve Project GC2023-096 e. Garza Extra-Territorial Agreement 3025 Westshore Dr. NE f. Reservoir 10 Final Design Amendment GC2022-069 g. Police Labor Agreement Wages Memorandum of Understanding Action taken: Deputy Mayor Martinez moved to approve the Consent Agenda as presented, second by Council Member Swartz. The motion carried 6 – 0. OLD BUSINESS #3 Fire Impact Fee Ordinance 3037 and Resolution 3956 This matter was presented in January 2020 and was postponed pending an update to the Capital Facilities Plan. A study session was held on September 12, 2023, to review the impact fees to replace fees currently being charged on new development under SEPA review. Fire Chief Brett Bastian explained that impact fees can only be spent on Fire Stations and not new equipment. The need for additional employees will depend on the call volume once a new station has been built. Action taken: Deputy Mayor Martinez moved to adopt Ordinance 3037 as presented, second by Council Member Skaug. The motion failed 3 – 3. Mayor Myers, Council Members Swartz, and Fancher were opposed. Action taken: Council Member Swartz moved to postpone this item to October 24, second by Mayor Myers. The motion carried 6 – 0. NEW BUSINESS #4 Proposed BMX Track Improvements The BMX Association has presented concepts for improvements to the BMX track adjacent to the Larson Recreation Center at no cost to the City. Staff will facilitate neighborhood meetings for input on the proposed lighting. BMX President Jeff Neihenke spoke on the changes and stated that the updates to the track could double their racing season. Their goal is to add a national event that would bring in 2,000 people per day. Action taken: Deputy Mayor Martinez moved to approve the improvements proposed by the BMX Association based on the recommendation of the Parks, Recreation, and Cultural Services Board, second by Council Member Skaug. The motion carried 6 – 0. #5 Grant County EHF Homeless Interlocal Agreement The funding will allow the city to continue operating the Open Doors Sleep Center in order to enforce the “No camping” policy on public property. The City of Moses Lake is a subrecipient to the grant, and the County is to “provide assistance and guidance” to the City of Moses Lake in meeting the program requirements. The City then expends the funds in accordance with the grant guidelines and submits invoices to the County on a monthly basis. Community Development Director Kirsten Peterson reviewed the Federal and State revenue and the allowed expenses. COML Council Packet 11-14-23, Page 25 of 277 CITY COUNCIL MINUTES – October 10, 2023 pg. 4 Action taken: Deputy Mayor Martinez moved to authorize the Interim City Manager to execute the contract with Grant County for acceptance of the Washington State Department of Commerce Emergency Housing Fund grant, with the budget amendment to keep the Sleep Center open, second by Council Member Fancher. The motion carried 6 – 0. ADMINISTRATIVE REPORTS Xeriscape Demonstration Update Parks staff have completed placement of gravel and replaced sprinklers with drip heads in the planter strip at 1345 S Pioneer Way. The cost was roughly $11,600, or $3.63 per square foot. Staff will work on expanding the concept around the City for further mitigation of water usage and reduction of routine maintenance. Water Resources Update City Engineer Richard Law is working with state agencies to do testing for Well 20 with hopes to have distribution available in the Spring. He is also working with the Bureau of Reclamation to do pilot testing in order to better estimate costs for treatment of canal or lake water. Assistant City Manager Rich Huebner is working with the Department of Commerce to reallocate grant funding to run lines from the lake at Larson Playfields to drilling a shallow well, a lower cost and shorter construction period. Interim City Manager Kevin Fuhr has a local advocate from the US Department of Agriculture assisting with approval process for low interest loans for our water infrastructure. COUNCIL COMMUNICATIONS AND REPORTS Council Member Skaug attended the Finance Committee Meeting and reports that the budget is tight and there are going to be some tough decisions ahead. EXECUTIVE SESSION Mayor Myers called an Executive Session from 8:42 p.m. to 9:12 p.m. to consider the price at which real estate will be offered for sale, to discuss performance of a public employee pursuant to RCW 42.30.110(1) subsection (g) with no action to follow. The Executive Session was extended to 9:25 p.m. ADJOURNMENT The regular meeting was adjourned at 9:25 p.m. ______________________________________ Don Myers, Mayor ATTEST____________________________ Debbie Burke, City Clerk COML Council Packet 11-14-23, Page 26 of 277 MOSES LAKE CITY COUNCIL – SPECIAL MEETING October 17, 2023 CALL TO ORDER The public portion of the special meeting of the Moses Lake City Council was called to order at 11:00 a.m. by Mayor Myers in Old Council Chambers. ROLL CALL Present: Mayor Myers; Deputy Mayor Martinez; Council Members Skaug, Fancher, and Madewell. Council Member Eck and Council Member Swartz were absent. BUDGET WORKSHOP Finance Director Madeline Prentice provided an updated budget showing where several cuts had been made to use the least amount of reserves possible, while still maintaining the required amount. The law enforcement sales tax levy will remain in the General Fund. The sales tax projection was increased from $10.1 million to $11 million, due to the projected funding for 2023 coming in at $11.65 million. The non-represented wage scale will be 11 steps with a 2.5% increase between each step. The non-represented employees will also get a 4% Cost of Living Allowance (COLA) increase. The budget, as presented, uses $4.5 million from reserves, leaving $6.6 million in the reserve account. ADJOURNMENT The meeting was adjourned at 12:00 p.m. ______________________________________ Don Myers, Mayor ATTEST____________________________ Debbie Burke, City Clerk COML Council Packet 11-14-23, Page 27 of 277 MOSES LAKE CITY COUNCIL October 24, 2023 CALL TO ORDER The regular meeting of the Moses Lake City Council was called to order at 6:30 p.m. by Mayor Myers in the Council Chambers of the Civic Center with audio remote access. Special notice for remote attendance and citizen comment were posted on the meeting agenda. ROLL CALL Present: Mayor Myers; Deputy Mayor Martinez; Council Members Eck, Fancher, Madewell, Swartz, and Skaug. PLEDGE OF ALLEGIANCE Mayor Myers led the Flag Salute. AGENDA APPROVAL Staff requested that Old Business item number 10, City Manager Contract, be added to the agenda. Action taken: Council Member Fancher moved to approve the Agenda as amended, second by Council Member Swartz. The motion carried 7 – 0. CITIZEN’S COMMUNICATION Miscellaneous Elisia Dalluge, Moses Lake, discussed the potential for the Moses Lake area to be a “Hydro Hub”. She shared her support of the Fire Impact Fees, and HopeSource, and spoke about water, fish fertilizer and the budget for the new Police Building. Neighbor Issues Ida Deeds, Moses Lake, requested Council change Municipal Codes due to her neighbor creating a large slingshot and using it to vandalize her property. Interim Police Chief Sands explained that they are working on a charge of Malicious Mischief but have no proof of the person using it. Economic Development Jeremy Nolan, Moses Lake, thanked Council and staff who attended the Public Utility District meeting regarding future growth and services, and encouraged attendance at future meetings. SUMMARY REPORTS MAYOR’S REPORT Native American Heritage Month Proclamation In accordance with RCW 28A.320.170, Mayor Myers proclaimed November 24 as Native American Heritage Day and November as Native American Heritage Month. COML Council Packet 11-14-23, Page 28 of 277 CITY COUNCIL MINUTES – October 24, 2023 pg. 2 CITY MANAGER’S REPORT Employee Introduction – IT Systems Administrator IT Systems Administrator Monte Sutton was introduced by Technology Services Director James Richmond. Animal Shelter Funding Grant County has offered up to $1 million in ARPA funding if the City would do a match in order to build a new Animal Shelter. Grant County also is donating land at the fairgrounds for the shelter to be built for vet services at their events. Grant County Commissioner Rob Jones and Grant County Animal Outreach President Sara Thompson-Tweedy provided comments on costs, regulations and adoptions. Action taken: Council Member Eck moved to approve up to $1 million match to the County, second by Council Member Swartz. The motion carried 6-1. Council Member Skaug was opposed. Council Members for Fire Committee Interim City Manager Kevin Fuhr asked for up to three City Council Members to be on the Fire Committee with a regionalization assessment consultant meeting next week. Deputy Mayor Martinez, and Council Members Madewell and Swartz showed interest. PUBLIC HEARINGS #1 Property Tax Levy Resolution 3957 RCW’s 84.52.020 and 82.52.070 require Council to annually adopt a resolution establishing the amount to be raised by property tax revenue for the ensuing fiscal year to support General Fund operations. Staff is requesting Council consider the maximum 1% increase in the levy plus utilize prior year “Banked Capacity” to provide funds necessary to discharge the anticipated expenditures and liabilities of the City’s General Fund. Mayor Myers opened the hearing at 7:30 p.m. There was no public testimony, and the hearing was closed. Action taken: Council Member Swartz moved to adopt Resolution 3957 as presented, second by Deputy Mayor Martinez. The motion carried 7 – 0. #2 2024 Budget Ordinance – First Presentation Finance Director Madeline Prentice provided an overview of budget priorities, considerations, summary of total budget, and staff changes. Mayor Myers opened the public hearing at 7:33 p.m. There was no public testimony, and the hearing was continued to November 14, 2023. CONSENT AGENDA #3 a. City Council meeting minutes dated September 26 and 28, 2023 b. Electronic Transfer: N/A Checks: 162631 - 162765 - $1,144,948.55 Payroll Checks: 10-13-2023 PR, #65923 - 65940 - $12,578.39 Electronic Payments: 10-13-2023 Direct Deposit: - $595,329.21 COML Council Packet 11-14-23, Page 29 of 277 CITY COUNCIL MINUTES – October 24, 2023 pg. 3 c. Cascade and Lakeview Parks Playground Acceptance d. Latecomer Contract Polo Ridge 4 Major Pal Street and Utility Resolutions 3958-3959 e. Accept Improvements for Polo Ridge 3 Major Plat Resolution 3960 f. Accept Improvements for Polo Ridge 4 Major Plat Resolution 3961 g. Accept Improvements for Barrington Point 5 Phase 1 Resolution 3962 Action taken: Deputy Mayor Martinez moved to approve the Consent Agenda as presented, second by Council Member Swartz. The motion carried 6 – 0. Council Member Fancher abstained. OLD BUSINESS 1 of 2 #4 Fire Impact Fee Ordinance 3037 and Resolution 3956 Fire Chief Brett Bastian fielded questions on the fire impact fees, explained that this was not a tax, that the funds could only be used for Fire Stations and discussed location options. The impact fees will eliminate the SEPA Mitigation fees that have been assessed. If there is a regionalization of the Fire Department, then the funds could be transferred with an interlocal agreement. Larry Angell with Barrington 5 subdivision stated that he was representing a client who wanted to ensure that the fees would be “fair, equitable and consistent.” Action taken: Deputy Mayor Martinez moved to adopt Ordinance 3037, as presented, second by Council Member Skaug. The motion carried 4 – 3. Council Members Swartz, Madewell and Eck were opposed. Action taken: Deputy Mayor Martinez moved to adopt Resolution 3956 as presented, second by Mayor Myers. The motion carried 7 – 0. #5 Interim Agreement for Sleep Center Operations Council directed staff to develop a new agreement with HopeSource to continue operations on an interim basis while Staff produced a Request for Proposals to solicit additional bids for operations of the Sleep Center. This contract will operate on a month-to-month basis and the funding for operations will be provided through the Emergency Housing Fund (EHF) from the Federal Government in the amount of $663,000 through June 30, 2024. Action taken: Deputy Mayor Martinez moved to authorize the Interim City Manager to execute the interim agreement with HopeSource, as presented, second by Council Member Eck. The motion carried 7 – 0. NEW BUSINESS #6 Harrison K Dano Park Sport Court Grant Proposal Staff has been coordinating with the Boys and Girls Club and Rave Sports on a potential project installing two sports courts at Harrison K Dano Park. The majority of the funding for the installation would come from grants from Rave sports with a philanthropic organization providing match for the project. The City's responsibility would be to COML Council Packet 11-14-23, Page 30 of 277 CITY COUNCIL MINUTES – October 24, 2023 pg. 4 provide the property and asphalted areas for the courts. Staff estimated paving costing at $25,000. Action taken: Council Member Fancher moved to approve the design for Futsal Courts as presented, second by Council Member Swartz. The motion carried 7 – 0. #7 Ice Arena 2023-2024 Season Fee Schedule Amendment Resolution 3963 The proposed amended fees include updates to the ranges that will encompass changes to the fee structure. This will accommodate the projected increases for next season, getting the Ice Arena fees on the same schedule going forward as the rest of the fee schedule. Action taken: Deputy Mayor Martinez moved to adopt Resolution 3963 to amend the fee schedule, as presented, second by Council Member Swartz. The motion carried 7 – 0. #8 Annual Review and Approval of LTAC Recommendations There is $375,000 available for grant distribution from Lodging Tax Advisory Committee (LTAC) funds in 2024, and an additional $150,000 in funds from the City’s portion of Lodging Tax funds, which was distributed mainly for Capital Expenditures. Applicants presented their projects during the LTAC meeting conducted on October 11. The LTAC members met again on October 12 to make their final recommendations of 23 applications for the full amount available. One application was not funded. Action taken: Council Member Fancher moved to approve LTAC funding for 2024, as presented, second by Council Member Swartz. The motion carried 7 – 0. #9 Volunteer Handbook Resolution 3964 The Volunteer Handbook is being proposed to be used for all regularly s city volunteers. The included policies are currently provided in the City of Moses Lake Employee Handbook, modified for volunteer usage and will accompany approved duties. Action taken: Council Member Swartz moved to adopt the volunteer handbook Resolution 3964, as presented, second by Deputy Mayor Martinez. The motion carried 7 – 0. OLD BUSINESS 2 of 2 #10 City Manager Contract There was recent interest for Interim City Manager, Kevin Fuhr, to fill the City Manager Position. There was a draft contract provided at the meeting. Action taken: Council Member Fancher moved to approve Mayor Myers to execute the City Manager contract for Kevin Fuhr, as presented, second by Council Member Eck. The motion carried 7 – 0. COUNCIL COMMUNICATIONS AND REPORTS Council Member Swartz attended the Community Development/Public Works meeting. He talked about how the water issue developments were going to affect more than just Moses Lake. Council Member Fancher attended the Grant County Economic Development Council Wednesday night, where they did a kick-off for their Capital Campaign membership drive. They COML Council Packet 11-14-23, Page 31 of 277 CITY COUNCIL MINUTES – October 24, 2023 pg. 5 had a goal of $2 million over the next five years, and already have an estimated $1.75 million commitment. Deputy Mayor Martinez attended the Watershed Committee Meeting. She reported that there has been a $3 million allocation for funding of lake clean-up to begin at Connelly Park. She also noted that the annual meeting for Columbia Basin Development League (CBDL) will be November 14. Mayor Myers thanked Council for their questions and tenacity on their decisions. EXECUTIVE SESSION Mayor Myers called an Executive Session from 9:15 p.m. to 9:30 p.m. to discuss potential litigation and performance of a public employee pursuant to RCW 42.30.110(1) subsection (i) and (g) with no action to follow. ADJOURNMENT The regular meeting was adjourned at 9:30 p.m. ______________________________________ Don Myers, Mayor ATTEST____________________________ Debbie Burke, City Clerk COML Council Packet 11-14-23, Page 32 of 277 Council Staff Report To:Agenda Item Number: From Department For Agenda of:Proceeding Type Subject Reviewed and Approved by: Expenditure Required:Amount Budgeted:Appropriation Required: Action Requested Packet Attachments (if any) Kevin Fuhr, City Manager 13138 Madeline Prentice, Director Finance 11/14/2023 Consent Agenda Disbursement Report since October 24, 2023 City Manager City Attorney Community Development Finance Fire Human Resources Parks, Rec, & Cultural Services Police Public Works Technology Services 7,223,369.68$7,223,369.68$0.00$ Approve payment of claims as presented. The following amounts were budgeted, and sufficient funds were available to cover these payments. Electronic Transfer: #282 - 312 - $5,234,793.58 Checks: 162766 - 163047 - $1,393,180.90 Payroll Checks: 10-27-2023 PR, #65941 - 65953 - $7,786.92 Electronic Payments: 10-27-2023 Direct Deposit: - $587,608.28 Vouchers - 11.14.2023.pdf 131.95KB COML Council Packet 11-14-23, Page 33 of 277 Overview Fiscal and Policy Implications Approve, Authorize, or Adopt: Provide Amended Direction: No Action Taken: RCW 42.24 governs the process for audit and review of claims and payroll payments for the City. RCW 42.24.180 requires the review and approval of all payments at a regularly scheduled public meeting on at least a monthly basis. The State Budgeting, Accounting and Reporting Systems (BARS) Manual outlines the above format for approval by the City Council. RCW 42.24.080 requires that all claims presented against the City by persons furnishing materials, rendering services or performing labor must be certified by the appropriate official to ensure that the materials have been furnished, the services rendered, or the labor performed as described, and that the claims are just, due and unpaid obligations against the City. RCW 42.24.180 allows expedited processing of the payment of claims when certain conditions have been met. The statute allows the issuance of warrants or checks in payment of claims before the legislative body has acted to approve the claims when: (1) the appropriate officers have furnished official bonds; (2) the legislative body had adopted policies that implement effective internal control; (3) the legislative body has provided for review of the documentation supporting the claims within a month of issuance; and (4) that if claims are disapproved, they shall be recognized as receivables and diligently pursued. The City meets all these conditions. To comply with the requirements, Finance staff schedule payment of claims and payroll for semi-monthly Council approval on the Consent Agenda. The payments listed in the schedule cover all claims and payroll payments during the period prior to the date of the Council meeting. All payments made during this period were found to be valid claims against the City. Details are attached and any questions should be directed to the City Manager or Finance Director. The City's internal controls include certification of the validity of all payments by the appropriate department prior to submission for payment. The Finance Director has delegated authority for the examination of vouchers and authorization of payments to the Finance, Accounts Payable, and Payroll staff. All payments are reviewed and validated. The Finance Division regularly reviews it processes to ensure appropriate internal controls are in place. Options and Results Approve N/A Staff would recognize claims as receivables and pursue collections. COML Council Packet 11-14-23, Page 34 of 277 TOTALS BY FUND:Est. Fund Bal.Est. Fund Bal. FUND NO FUND NAME 11/1/2023 AMOUNT @11/14/2023 001 GENERAL FUND 12,261,658          3,794,116.43                   8,467,542              102 TOURISM 1,474,786             35,733.68                         1,439,053              103 GRANTS AND DONATIONS 1,187,814             1,412.61                           1,186,401              105 ARPA 3,712,452             ‐                                     3,712,452              110 HOMELESS SERVICES 620,706                16,406.66                         604,299                 111 OPIOID ABATEMENT 50,358                  ‐                                     50,358                   114 PATHS/TRAILS 115,781                ‐                                     115,781                 116 STREET 713,913                172,844.54                      541,068                 119 STREET REPR/RECON 3,181,479             20,010.39                         3,161,469              170 TRANSPORTATION BENEFIT DISTRICT 1,166,388             ‐                                     1,166,388              282 LOCAL BORROWING 1,423,707             ‐                                     1,423,707              286 REFUNDING GO BONDS 2015 122,434                ‐                                     122,434                 314 PARK & RECREATION IMPROVEMENTS 588,488                202.50                              588,286                 315 PARK MITIGATION CAPITAL PROJECTS 38,997                  ‐                                     38,997                   320 FIRE MITIGATION ‐ SEPA 339,934                ‐                                     339,934                 322 WATER REMIDIATION 1,947,372             15,522.33                         1,931,849              410 WATER/SEWER 9,069,493             564,433.38                      8,505,060              450 2011 BOND FUND 10,304                  ‐                                     10,304                   451 WATER/SEWER ‐ 2011 BOND RESERVE 567,600                ‐                                     567,600                 452 2004 BOND FUND 1,020,000             ‐                                     1,020,000              453 WATER/SEWER ‐ 2004 BOND RESERVE 701,500                ‐                                     701,500                 471 WATER RIGHTS 1,556,057             ‐                                     1,556,057              477 WATER SEWER CONSTRUCTION 3,240,245             400,342.52                      2,839,903              485 PWFT WATER/SEWER DEBT SERVICE 20,196                  ‐                                     20,196                   487 2015 GO BONDS REDEMPTION 9,555                    ‐                                     9,555                     490 SANITATION 2,246,873             83,046.03                         2,163,827              493 STORM WATER 1,036,919             99,113.80                         937,805                 495 AIRPORT 73,829                  4,721.09                           69,108                   498 AMBULANCE 796,758                555,088.93                      241,669                 501 UNEMPLOYMENT COMPENSATION INSURANCE 90,558                  375.00                              90,183                   503 SELF‐INSURANCE 193,347                1,305.79                           192,042                 517 CENTRAL SERVICES 1,115,999             189,270.47                      926,729                 519 EQUIPMENT RENTAL 2,089,751             392,814.96                      1,696,936              528 BUILDING MAINTENANCE 2,332,252             272,913.22                      2,059,339              611 FIRE PENSION 435,927                1,377.32                           434,550                 623 DEPOSIT 177,724                2.00                                   177,722                 631 STATE 29,180                  6,920.83                           22,259                   TOTAL 55,760,336$        6,627,974.48$                 49,132,362           City of Moses Lake Tabulation of Claims Paid‐Summary by Fund Council Meeting Date‐ 11/14/2023 COML Council Packet 11-14-23, Page 35 of 277 Check Name Check Amount Check Date Invoice Description 282 Dept. of Employment Security 33,576.82 09/30/2022 PFML Premiums 283 Dept. of Employment Security 26,568.08 12/31/2022 PFML Premiums 284 Dept. of Employment Security 45,300.01 03/31/2023 PFML Premiums 285 Dept. of Employment Security 42,454.04 06/30/2023 PFML Premiums 286 Dept Of Labor & Industries 152,713.90 09/30/2022 L&I  287 Dept Of Labor & Industries 103,964.71 12/31/2022 L&I 288 Dept Of Labor & Industries 128,128.95 03/31/2023 LNI 289 Dept Of Labor & Industries 119,462.25 06/30/2023 LNI 290 Dept Of Labor & Industries 169,515.33 10/17/2023 LNI 291 Dept Of Retirement Systems 129,780.29 04/30/2023 DRS Contributions 292 Dept Of Retirement Systems 125,534.73 05/12/2023 2310 DRS Retirement 293 Dept Of Retirement Systems 126,751.43 05/31/2023 DRS Contributions 294 Dept Of Retirement Systems 129,782.70 06/09/2023 2312 DRS Contributions 295 Dept Of Retirement Systems 259,211.37 07/07/2023 2313 DRS 296 Dept Of Retirement Systems 248,869.15 08/04/2023 2316 DRS Contributions 297 Dept Of Retirement Systems 130,419.94 08/30/2023 2317 DRS Contributions 298 Dept Of Retirement Systems 263,961.65 09/20/2023 2318 DRS Retirement 299 Montana Department of Revenue 144.00 03/10/2023 2305 Deduction K Blasdel 300 Aflac 2,435.20 10/10/2023 2320 AFLAC 301 Dept Of Retirement Systems 127,257.13 10/04/2023 2320 DRS Retirement 302 FICA‐Medicare 194,915.72 04/14/2023 2308 Payroll Taxes 303 FICA‐Medicare 178,978.78 04/28/2023 2309 Payroll Taxes 304 FICA‐Medicare 42,904.49 04/30/2023 Payroll Taxes 305 FICA‐Medicare 366,810.04 05/31/2023 2310 Payroll Taxes 306 FICA‐Medicare 412,492.07 06/30/2023 2312 Payroll Taxes 307 FICA‐Medicare 432,414.51 07/31/2023 2314 Payroll Taxes 308 FICA‐Medicare 427,103.16 08/31/2023 2316 Payroll Taxes 309 FICA‐Medicare 615,661.16 09/30/2023 2318 Payroll Taxes 310 FICA‐Medicare 190,450.56 10/31/2023 2321 Payroll Taxes 311 Dept Of Retirement Systems 429.83 10/31/2023 NLEC Reporting August 2023 312 Dept of Revenue‐ EFT 6,801.58 10/31/2023 Quarter 3 2023 Leasehold Tax 162766 A & H Printers Inc 63.96 10/18/2023 DeLaTorre Business Cards 162767 Abc Hydraulics 1,664.52 10/18/2023 Dot Tubing 162768 Als Glass Service Inc 684.67 10/18/2023 Windshield & Installation 162769 Amazon Capital Services, Inc.6,364.99 10/18/2023 Amazon Purchases 162770 Anna Enriquez 43.40 10/18/2023 Museum Consignment Sales 162771 Badger Meters Inc 846.36 10/18/2023 Meter Read Services 162772 Barbara Nickerson 25.20 10/18/2023 Museum Consignment Sales 162773 Basin Refrigeration & Heat Inc 3,663.88 10/18/2023 Plumbing Services @ Sleep Center 162774 Basin Septic Services Inc 220.00 10/18/2023 Sanitizer Station Services 162775 Bound Tree Medical LLC 757.19 10/18/2023 Medical Supplies 162776 Bud Clary Ford LLC 187,315.40 10/18/2023 Vehicles and Parts Purchases 162777 Cascade Natural Gas Corp 420.62 10/18/2023 Natural Gas Utilities 162778 Central Machinery Sales Inc 876.41 10/18/2023 Switch/Glass/Equipment 162779 Central Wash Asphalt Inc 92.10 10/18/2023 Gravel 162780 Centurylink 1,648.95 10/18/2023 Telephone Services 162781 Christian Olson 28.70 10/18/2023 Museum Consignment Sales 162782 Columbia Basin Herald 572.55 10/18/2023 Museum Ad City of Moses Lake Checks Issued with Summary Description For November 14th, 2023 Council Meeting COML Council Packet 11-14-23, Page 36 of 277 162783 Columbia Basin Water Works Inc 10,655.33 10/18/2023 Large Meter Testing 2023‐2026 162784 Copiers Northwest Inc 142.95 10/18/2023 Equipment Contract Fees 162785 CSWW, Inc 230.50 10/18/2023 Tools/Equipment 162786 Databar Inc 3,555.45 10/18/2023 Utility Billing Invoices 162787 Dell Marketing 1,571.73 10/18/2023 Laptop Replacement 162788 ESO Solutions Inc 2,354.70 10/18/2023 Inspections and Pre‐Plan Software 162789 Faber Industrial Supply 443.64 10/18/2023 Meter Reader Supplies 162790 Fastenal Company 38.21 10/18/2023 Hex Cap Screws/Gloves 162791 Fishingmagician.com 300.00 10/18/2023 LTAC Advertising 162792 Galls LLC 1,096.22 10/18/2023 Uniform Pieces 162793 General Fire Apparatus Inc 56.89 10/18/2023 Battery Box Cover 162794 GMCO Corpoation 8,501.77 10/18/2023 Torch CI 162795 Grainger Parts Operations 480.96 10/18/2023 Air Filters 162796 Grant Co Solid Waste 70,004.94 10/18/2023 Landfill Dumping Fees 162797 Grant County Treasurer 19,731.56 10/18/2023 2023 Property Taxes 162798 Grant County Treasurer 995.60 10/18/2023 Liquor Profits Sept. '23 162799 Greg Graffe 84.00 10/18/2023 Museum Consignment Sales 162800 Haglund's Trophies, LLC 37.61 10/18/2023 IT Employee Name Plate 162801 Heartland Agriculture, LLC 135.87 10/18/2023 Adapters/Caps/Dust Caps 162802 IAFF Local 1258 5,945.00 10/18/2023 2321 IAFF Fire Dues 162803 Ibs Inc 1,243.40 10/18/2023 Maintenance Supplies 162804 Ims Alliance 13.71 10/18/2023 Accountability Tags ‐ Rice 162805 J.J. Keller & Associates, Inc.1,186.98 10/18/2023 HR Software 162806 Jerrys Auto Supply 185.39 10/18/2023 Oil Absorbent 162807 Kassandra Wiggum 38.50 10/18/2023 Museum Consignment Sales 162808 Katherine Kenison, PS 18,552.00 10/18/2023 City Atty Services Sept. 2023 162809 Kathleen Parr 28.70 10/18/2023 Museum Consignment Sales 162810 Keller Associates 113,411.94 10/18/2023 Wastewater Plan 162811 Kelley Connect 325.22 10/18/2023 Equipment Contract Fees 162812 King5.Com 2,000.00 10/18/2023 LTAC Advertising 162813 Kris Chudomelka 37.80 10/18/2023 Museum Consignment Sales 162814 Lakeside Disposal, Inc 25.67 10/18/2023 Recycling @ Fire 162815 Lee Ann St Clair 107.80 10/18/2023 Museum Consignment Sales 162816 LexisNexis Risk Solutions 0.38 10/18/2023 Investigations Costs 162817 Lowes 1,742.91 10/18/2023 September Statement 162818 Maria Morales 31.50 10/18/2023 Museum Consignment Sales 162819 Martin Schempp 200.90 10/18/2023 Museum Consignment Sales 162820 Matrix Sciences International Inc.240.00 10/18/2023 Sample Testing 162821 McKesson Medical‐Surgical 207.57 10/18/2023 Medical Supplies 162822 Med Tech Resource Inc 664.87 10/18/2023 Medical Supplies 162823 Media Index Publishing 2,700.00 10/18/2023 LTAC Advertising 162824 Merle Hardy 63.00 10/18/2023 Museum Consignment Sales 162825 Michael Reed 30.80 10/18/2023 Museum Consignment Sales 162826 Moses Lake Police Guild 2,730.00 10/18/2023 2321 Police Dues 162827 Moses Lake Steel Supply 9.19 10/18/2023 Fender Washers 162828 NB Engineering, LLC 12,330.75 10/18/2023 Stormwater Comp Plan 162829 Norco Enterprises Inc 322.22 10/18/2023 Medical Oxygen 162830 Northstar Chemical Inc 2,213.75 10/18/2023 Sodium Hypochlorite Well # 14 162831 NYS Child Support Prosessing Center 184.61 10/18/2023 Gilmartin Child Support 162832 Oasis Auto Spa 1,328.80 10/18/2023 Car Washes‐September 2023 162833 Parker Corporate Services, Inc 21,229.94 10/18/2023 Security September 2023 162834 Perteet, Inc.925.00 10/18/2023 Zoning Pro Services 162835 Protect Youth Sports 312.80 10/18/2023 Background Checks 162836 Public Safety Testing Inc 925.00 10/18/2023 Subscriptions Fees July‐Sept COML Council Packet 11-14-23, Page 37 of 277 162837 Pud Of Grant County 83,383.14 10/18/2023 Electric Services 162838 Qcl Inc 76.00 10/18/2023 Pre Employment Testing 162839 Quill Corporation 227.52 10/18/2023 Break Room Supplies 162840 R&M Hansen, Inc 1,236.56 10/18/2023 Laundry @ Sleep Center 162841 Racom Corporation 6,892.98 10/18/2023 Portable Batteries 162842 Rexel USA 551.44 10/18/2023 Tools/Equipment 162843 RH2 Engineering Inc.20,976.62 10/18/2023 Reservoir 10 Construction 162844 Rolluda Architects, Inc.68,912.04 10/18/2023 Police Department Design 162845 Salt Distributors, INC 58,237.12 10/18/2023 Corrosion Inhibited Salt 162846 Sea Western Inc 219.62 10/18/2023 Bunker Boots ‐ Rice 162847 Sigrid Penrod 107.80 10/18/2023 Museum Consignment Sales 162848 Sirennet.Com 464.61 10/18/2023 Push Bumper Transfer Kit 162849 Skaug Brothers Carpet One 126.49 10/18/2023 Linoleum 162850 SolelyOn Broadcasting, LLC 1,286.00 10/18/2023 LTAC Advertising 162851 Target Solutions Learning 99.99 10/18/2023 Scheduling Software Support 162852 Traffic Safety Supply Company 1,223.20 10/18/2023 30" Oct Blanks 162853 Trilogy Medwaste West, LLC 39.00 10/18/2023 Pharmaceutical Waste Management 162854 Trojan Technologies 2,738.31 10/18/2023 Sensor Assembly 162855 Ups Freight 120.76 10/18/2023 Shipping & Service Fees 162856 Util Undrgrnd Location Center 99.33 10/18/2023 Underground Locates September 2023 162857 Verizon Wireless 12,325.76 10/18/2023 Cell Phone Services 162858 William Scotsman, Inc 894.30 10/18/2023 Rental @ Sleep Center 162859 WSCCCE, AFSCME, AFL‐CIO 2,397.53 10/18/2023 AFSCME Dues 162860 Zoll Medical Corp 1,009.35 10/18/2023 Medical Supplies 162861 Alderbrook Homes 161.40 10/20/2023 Refund Utility Overpayment 162862 Alderbrook Homes 87.06 10/20/2023 Refund Utility Overpayment 162863 CAD Homes 53.58 10/20/2023 Refund Utility Overpayment 162864 Tatyana Kolosnitsyn 217.34 10/20/2023 Refund Utility Overpayment 162865 Washington State Association of Fire Chiefs 450.00 10/26/2023 Fire Inspector Class 162866 A & H Printers Inc 1,312.73 10/26/2023 Business Cards 162867 Ag Supply Ace Hardware 12.79 10/26/2023 Nylon Rope 162868 Als Glass Service Inc 384.82 10/26/2023 Excavator Windshield 162869 American Linen Inc 1,287.42 10/26/2023 Linen Supplies 162870 Anatek Labs, Inc.4,590.00 10/26/2023 Sample Testing 162871 Aspect Consulting 14,493.75 10/26/2023 Water Source Alternatives Assessment 162872 AT&T Mobility II, LLC 220.00 10/26/2023 Investigations Costs 162873 Badger Meters Inc 207,744.26 10/26/2023 Meter Parts 162874 Battery Systems Inc 8.31 10/26/2023 Battery 162875 Bud Clary Ford LLC 62,223.87 10/26/2023 2023 Ford Police Interceptor SUV  162876 Bud Clary Toyota Chevrolet 430.63 10/26/2023 Key/Transmitter 162877 Cascade Natural Gas Corp 135.36 10/26/2023 SNS Utilities 162878 Centurylink 316.06 10/26/2023 Water Shut‐Off Notifications 162879 Centurylink 3,541.72 10/26/2023 Telephone Services 162880 Code Publishing Co.830.00 10/26/2023 Annual Web Fees 162881 Columbia Basin Herald 60.81 10/26/2023 Ordinance Ad 162882 Commercial Tire Inc 437.15 10/26/2023 Pata ATR Tires 162883 Copiers Northwest Inc 296.31 10/26/2023 Equipment Contract Fees 162884 CSWW, Inc 1,316.39 10/26/2023 Pants/Tools 162885 Databar Inc 1,455.42 10/26/2023 Utility Billing Invoices 162886 Dobbs Peterbilt‐ Moses Lake 484.94 10/26/2023 Insta‐Chain 162887 Dr Lou Sowers 700.00 10/26/2023 Pre Employment Evaluation 162888 Empire Well Drilling, LLC 14,993.00 10/26/2023 Wells 9,17,31,33 and Dunes Well  162889 Faber Industrial Supply 96.82 10/26/2023 Torque Wrench 162890 Fastenal Company 2,254.89 10/26/2023 Saw Blades COML Council Packet 11-14-23, Page 38 of 277 162891 Gray & Osborne, Inc.19,096.15 10/26/2023 East Canal Water Quality Investigation 162892 Ground Penetrating Radar Systems, LLC 7,900.00 10/26/2023 Loop Drive Sewer Lateral Inspection 162893 H D Fowler Company 803.00 10/26/2023 Meter Parts 162894 Hajoca Corp 1,871.92 10/26/2023 Misc. Parts 162895 Home Depot Credit Services 2,996.03 10/26/2023 September Statement 2023 162896 Inland Body & Paint 4,194.52 10/26/2023 Repair Eq. # 158 162897 Jerrys Auto Supply 207.72 10/26/2023 Hose 162898 Kent D. Bruce Co LLC 291.16 10/26/2023 AFS, Cable Pass Through 162899 Lad Irrigation Company Inc 547.91 10/26/2023 Blue Heron Irrigation 162900 Moon Security Services Inc 307.65 10/26/2023 Museum Security 162901 Northstar Chemical Inc 302.50 10/26/2023 Sodium Hypochlorite Well # 4 162902 Norton Corrosion Limited LLC 1,145.00 10/26/2023 Inspection Cathodic Protection System 162903 Oasis Auto Spa 1,487.20 10/26/2023 Car Washes July 2023 162904 Oreilly Auto Parts 38.79 10/26/2023 Shift Mechanism 162905 Paramount Supply Company 570.11 10/26/2023 3" Gaskets 162906 Pasco Tire Factory, INC 5,749.12 10/26/2023 Tires 162907 Perteet, Inc.25,695.89 10/26/2023 Moses Lake Admin Support 162908 Pro Touch Car Wash & Auto Detail LLC 11.83 10/26/2023 September Car Washes 162909 Qcl Inc 560.00 10/26/2023 Annual Audiogram Testing 162910 Rexel USA 206.56 10/26/2023 LED Light Bulb 162911 RH2 Engineering Inc.25,149.13 10/26/2023 On‐Call Electrical Engineering 162912 Ron Lom Murphy 6,625.00 10/26/2023 Rope Rescue Class 162913 Sand Scorpions ORV Group 35,733.68 10/26/2023 LTAC  Bounty Hole Event 162914 Signs Now, LLC 1,494.39 10/26/2023 Graphics Package Eq. # 054 162915 SolelyOn Broadcasting, LLC 1,275.00 10/26/2023 LTAC Advertising 162916 Summit Law Group 8,507.44 10/26/2023 HR Pro Services 162917 Ups Freight 101.39 10/26/2023 Shipping & Service Fees 162918 Usa Blue Book 1,527.80 10/26/2023 Eye Wash Basin/Pump Assemblies 162919 Waste Mgt Recycle America Inc 3,380.42 10/26/2023 Commingle Loads 162920 Weinstein Beverage Company 75.50 10/26/2023 Water 162921 Ziggys 65.04 10/26/2023 Posts 162922 A Leonard Smith 2.00 10/27/2023 Overpaid Invoice PW23.131 162923 Beltran Partners, LLC 85.00 10/27/2023 City Endorsement Not Required 162924 Benjamin Guzman 211.38 10/27/2023 2023 Boot Allowance 162925 Captain's Cod Company 85.00 10/27/2023 No City Endorsement Required 162926 Cherianne Bickler 571.25 10/27/2023 Class Expenses Reimbursement 162927 Damien Rommal 1,638.92 10/27/2023 Sewer Adjustment Posted in Error 162928 Dr. Michelle Liu 62.70 10/27/2023 Mileage Reimbursement 162929 Joey Barkle 249.54 10/27/2023 2023 Boot Allowance 162930 Joey Clifner 209.00 10/27/2023 CDL Endorsement 2023 162931 Joey Clifner 128.00 10/27/2023 CDL Physical Reimbursement 162932 Laura Elzig 16.99 10/27/2023 Workshop Purchase Reimbursement 162933 Lee Silliman 1,000.00 10/27/2023 Exhibit‐ "Rainier Remembered" 162934 Manuel De La Torre 156.00 10/27/2023 CDL Endorsement 2023 162935 Nathan Aamold 155.00 10/27/2023 CPAT Test Reimbursement 162936 North Central Construction 159.90 10/27/2023 Overpayment Refund 162937 Ray Toler 315.00 10/27/2023 Withdrew Dock Install Application 162938 Skaug Brothers Carpet One 1,128.95 10/27/2023 Civic Center Building Carpet Project 162939 Washington State Treasurer 304.24 10/27/2023 State Remittance Period Ending 9.30 162940 Zach Fiest 139.00 10/27/2023 CPAT Test Reimbursement 162941 Janelle Sword 732.71 10/31/2023 LEOFF Retiree Pension Oct. 2023 162942 Luther Stowers 644.61 10/31/2023 LEOFF Retiree Pension Oct. 2023 162943 Wash Council Police & Sheriffs 525.00 10/31/2023 2321 WCPS Police Dues 162944 Columbia Basin Water Works Inc 650.98 11/01/2023 Meter Testing Retainage Release COML Council Packet 11-14-23, Page 39 of 277 162945 D L T Solutions Inc 8,212.44 11/02/2023 Software Renew 162946 A & H Printers Inc 140.92 11/03/2023 Business Cards 162947 AAA Readymix Inc 1,960.93 11/03/2023 Concrete Delivery 162948 Advanced Traffic Products 78.16 11/03/2023 Traffic Signal Parts ‐ Credit Used 162949 Airgas Usa 708.33 11/03/2023 Operating Supplies 162950 Amazon Capital Services, Inc.1,866.47 11/03/2023 Credit for Returned Item 162951 Anatek Labs, Inc.858.00 11/03/2023 Sample Testing 162952 Badger Meters Inc 850.31 11/03/2023 Meter Read Services 162953 Battery Systems Inc 140.84 11/03/2023 Battery DC31MF 162954 Bound Tree Medical LLC 6,902.11 11/03/2023 Medical Supplies 162955 Bud Clary Ford LLC 381.95 11/03/2023 Wheel Assembly 162956 Bud Clary Toyota Chevrolet 190.78 11/03/2023 Program Keys 162957 Central Machinery Sales Inc 171.47 11/03/2023 Ice Rink Supplies 162958 Centurylink 1,396.13 11/03/2023 Contract Services 162959 Centurylink 55.41 11/03/2023 206‐T03‐6229 331B 10.23.23 162960 Coaxsher, Inc.2,340.95 11/03/2023 PPE Dual Compliance 162961 Columbia Basin Herald 666.62 11/03/2023 Planning/Ordinance Advertising 162962 Commercial Tire Inc 344.08 11/03/2023 LT245/75R17 Tires 162963 Consolidated Disposal Service 4,237.62 11/03/2023 Disposal Loads 162964 Consolidated Electrical Distributors Inc 531.79 11/03/2023 Ballast Disconnects/Distributors 162965 Copiers Northwest Inc 625.26 11/03/2023 Equipment Contract Fees 162966 CSWW, Inc 1,246.39 11/03/2023 Staff PPE 162967 Databar Inc 1,999.24 11/03/2023 Utility Billing Invoices 162968 Day Wireless Systems 85.80 11/03/2023 Pager Batteries 162969 Devries Information Mgmt 34.50 11/03/2023 On Site Record Destruction 162970 Dobbs Peterbilt‐ Moses Lake 141.20 11/03/2023 Ball Joint 162971 Equifax / Talx UC Express Inc 375.00 11/03/2023 Unemployment Claims Management 162972 Faber Industrial Supply 250.73 11/03/2023 Flood Light 162973 Fastenal Company 35.33 11/03/2023 Safety Glasses 162974 Fehr & Peers 20,010.39 11/03/2023 ML Travel Demand Model Development 162975 Ferrellgas 33.16 11/03/2023 Propane 162976 Galls LLC 645.88 11/03/2023 Uniform 162977 General Fire Apparatus Inc 331.16 11/03/2023 Uniform 162978 Grainger Parts Operations 29.07 11/03/2023 Dust Cover 162979 Grant Co Solid Waste 49.30 11/03/2023 Yard Cleanup 162980 Grant County Animal Outreach 8,333.00 11/03/2023 Contract Contribution 162981 Grant County Treasurer 859.42 11/03/2023 Liquor Excise 2% 162982 Heartland Agriculture, LLC 742.54 11/03/2023 Water Pump 162983 Home Depot Pro (Supplyworks)2,949.16 11/03/2023 Custodial Supplies 162984 Inland Body & Paint 1,298.82 11/03/2023 Repair Eq. # 003 162985 International Code Council 160.00 11/03/2023 Beach 2024 Membership 162986 Jerrys Auto Supply 194.78 11/03/2023 LED License Kit/Bracket 162987 Jims Lock Service LLC 32.52 11/03/2023 Keys 162988 Kelley Connect 1,042.19 11/03/2023 Equipment Contract Fees 162989 Lad Irrigation Company Inc 55.37 11/03/2023 Irrigation Supplies 162990 Localtel Communications 1,206.30 11/03/2023 Internet Services 162991 Matrix Sciences International Inc.99.00 11/03/2023 Sample Testing 162992 McKesson Medical‐Surgical 512.65 11/03/2023 Medical Supplise 162993 Med Tech Resource Inc 63.75 11/03/2023 Medical Supplies 162994 Moon Security Services Inc 78.49 11/03/2023 Security @ Annex November 23 162995 Moses Lake Men's Softball 960.00 11/03/2023 Tournament Fee 162996 Moses Lake Steel Supply 179.26 11/03/2023 Threaded Rod/Bandsaw Blades 162997 Multi Agency Comm Center E911 11,797.64 11/03/2023 EMS & Fire Calls November 23 162998 Norco Enterprises Inc 755.09 11/03/2023 Medical Supplies COML Council Packet 11-14-23, Page 40 of 277 162999 North Central Laboratories 281.83 11/03/2023 Lab Supplies 163000 Northstar Chemical Inc 4,647.50 11/03/2023 Sodium Hypochlorite Well #12 163001 NYS Child Support Prosessing Center 184.61 11/03/2023 Gilmartin Child Support 163002 Oreilly Auto Parts 34.41 11/03/2023 HVAC Actuator 163003 Oxarc Inc 92.83 11/03/2023 Building Operating Supplies 163004 Protect Youth Sports 645.35 11/03/2023 Background Checks 163005 Quill Corporation 388.24 11/03/2023 Tea/Cocoa/Supplies 163006 Racom Corporation 406.50 11/03/2023 Radio Tech Service Ladder Truck 1 163007 Rexel USA 195.63 11/03/2023 Ice Rink Supplies 163008 ScribSoft Holdings, Inc.3,000.00 11/03/2023 Subscription 163009 Sea Western Inc 146.34 11/03/2023 Quarterly Air Test Q4‐#467426 163010 Signs Now, LLC 1,744.97 11/03/2023 Stripe Repair Eq. # 003 163011 Systems Design West, LLC 5,279.74 11/03/2023 EMS Billing for September 163012 The DOH Associates 202.50 11/03/2023 LRC Pro Services 163013 Trilogy Medwaste West, LLC 39.00 11/03/2023 RMW Monthly Service for September 163014 United Rentals 1,169.63 11/03/2023 Rental ‐ Ice Rink 163015 Ups Freight 37.26 11/03/2023 Weekly Service Fees 163016 UPS Store 2469 54.91 11/03/2023 Shipping 163017 Usa Blue Book 1,356.52 11/03/2023 ORP Probe/ORP Standard 163018 Vimly Benefit Solutions, Inc 2,422.35 11/03/2023 Williams Cobra November 2023 163019 Wa Cities Insurance Authority 1,305.79 11/03/2023 Large Deductible Program 163020 Washington State Patrol 222.00 11/03/2023 Background Checks 163021 Weinstein Beverage Company 1,008.10 11/03/2023 Maintenance Supplies 163022 Wenatchee Valley Hospital 55.67 11/03/2023 Pre‐Employment Medical Testing 163023 William Scotsman, Inc 2,277.87 11/03/2023 Rental @ Sleep Center 163024 Zoll Medical Corp 3,328.05 11/03/2023 Medical Supplies 163025 Brandon Gray 228.33 11/06/2023 Refund Utility Overpayment 163026 GMTPM 344.14 11/06/2023 Refund Utility Overpayment 163027 Marianna Connery 184.20 11/06/2023 Refund Utility Overpayment 163028 Megan Alcott 140.15 11/06/2023 Refund Utility Overpayment 163029 Robin L. Cusato‐Wood 116.69 11/06/2023 Refund Utility Overpayment 163030 Seattle RE Group LLC 116.52 11/06/2023 Refund Utility Overpayment 163031 SLUKMU LLC 182.69 11/06/2023 Refund Utility Overpayment 163032 SMITH KATHIE 164.35 11/06/2023 Refund Utility Overpayment 163033 The Estate of Linda McKenzie 246.02 11/06/2023 Refund Utility Overpayment 163034 The Estate of Peggy L. Duncan 54.86 11/06/2023 Refund Utility Overpayment 163035 THOMAS CARLSON 343.77 11/06/2023 Refund Utility Overpayment 163036 Trisha M. Spencer 827.00 11/06/2023 Refund Utility Overpayment 163037 VIRGIL GERING 171.22 11/06/2023 Refund Utility Overpayment 163038 William Rutherford 190.21 11/06/2023 Refund Utility Overpayment 163039 Scott Allsbrook 118.00 11/06/2023 2023 Weed Conference CEU's 163040 Dean McPherson 118.00 11/06/2023 2023 Weed Conference CEU's 163041 Steven Miers 64.43 11/06/2023 Fuel Reimbursement 163042 Rudy Valdez 243.00 11/06/2023 Level 2 Instructor 2023 163043 Benjamin Schober 58.00 11/06/2023 Trimble Regional User Group 163044 James Burns 355.00 11/06/2023 Fire Officer 2 Courses 2023 163045 Cindy Smith 79.00 11/06/2023 Trimble Regional User Group 163046 Adam McFayden 395.00 11/06/2023 Residential Mechanical Inspector 163047 Gilberto Rangel 130.77 11/06/2023 Boot Reimbursement 2023 6,627,974.48$   COML Council Packet 11-14-23, Page 41 of 277 Council Staff Report - Draft Review To:* From * Department* For Agenda of:*Proceeding Type * Subject* To be reviewed by:* Expenditure Required:*Amount Budgeted:*Appropriation Required:* Kevin Fuhr, City Manager Enter Director Name Kirsten Peterson, Director Community Development 11/14/2023 Consent Agenda Fire Impact Fee Appeal Update Ordinance City Manager City Attorney Community Development Finance Fire Human Resources Parks, Rec, & Cultural Services Police Public Works Technology Services $0.00 $0.00 $0.00 COML Council Packet 11-14-23, Page 42 of 277 Action Requested * Packet Attachments (if any) Staff recommends City Council motion to... Staff recommends Council move to adopt the Ordinance as presented. Upload final version(s) in order of exhibit with identifiable file names × Upload fire impact fee amendment 01.docx 21.99KB COML Council Packet 11-14-23, Page 43 of 277 Overview* Fiscal and Policy Implications * City Council adopted Ordinance 3037 on October 24, 2023 to implement the new Fire Impact Fee in the permitting process. Upon further legal review it was determined that MLMC 21.03.140(c) does not provide clear guidance regarding the appeal process. Staff is now proposing a minor amendment to the ordinance to clearly specify that the appellant is the party responsible for establishing evidence on points raised in the appeal process. n-a COML Council Packet 11-14-23, Page 44 of 277 Approve, Authorize, or Adopt:* Provide Amended Direction:* No Action Taken:* Submitted by:Submitter Email Options and Results The Code will be updated to reflect the change as presented. Staff will bring back options for recommended changes. The Code will remain unclear on burden of proof process. Debbie Burke dburke@cityofml.com COML Council Packet 11-14-23, Page 45 of 277 ORDINANCE NO. 3039 AN ORDINANCE OF THE CITY OF MOSES LAKE, WASHINGTON, AMENDING SECTION 21.03.140 OF THE MOSES LAKE MUNICIPAL CODE TITLED “APPEALS” THE CITY COUNCIL OF THE CITY OF MOSES LAKE DO ORDAIN AS FOLLOWS: Section 1. Section 21.03.140 of the Moses Lake Municipal Code titled “Appeals” is amended as follows: 21.03.140 Appeals. (a) An appeal of an impact fee imposed on a building permit may only be filed by the applicant of the building permit for the subject property. An applicant may either file an appeal and pay the impact fee imposed by this chapter under protest or appeal the impact fee before issuance of the building permit. No appeal may be filed after the impact fee has been paid and the building permit has been issued. (b) An appeal shall be filed with the hearing examiner on the following determinations of the director: (1) The applicability of the impact fees to a given building permit pursuant to Sections 21.03.030 and 21.03.050; (2) The decision on an independent fee calculation in Section 21.03.050; or (3) Any other determination which the director is authorized to make pursuant to this chapter. (c) An appeal, in the form of a letter of appeal, along with the required appeal fee, shall be filed with the department for all determinations by the director, prior to issuance of a building permit. Appellant has the burden of proof with respect to the points raised on appeal and has the burden of establishing that the director’s determination is not supported by a preponderance of the evidence or was clearly erroneous. The letter must contain the following: (1) A basis for and arguments supporting the appeal; and COML Council Packet 11-14-23, Page 46 of 277 (2) Technical information and specific data supporting the appeal. (d) The fee for filing an appeal shall be set forth in the adopted Moses Lake Land Use Fee Schedule. (e) Within twenty-eight calendar days of the filing of the appeal, the director shall mail to the hearing examiner the following: (1) The appeal and any supportive information submitted by the appellant; (2) The director’s determination along with the record of the impact fee determination and, if applicable, the independent fee calculation; and (3) A memorandum from the director analyzing the appeal. (f) The hearing examiner shall review the appeal from the applicant, the director’s memorandum, and the record of determination from the director. No oral testimony shall be given, although legal arguments may be made. The determination of the director shall be accorded substantial weight. (g) The hearing examiner is authorized to make findings of fact and conclusions of law regarding the decision. The hearing examiner may, so long as such action is in conformance with the provisions of this chapter, reverse or affirm, in whole or in part, or modify the determination of the director, and may make such order, requirements, decision or determination as ought to be made, and to that end shall have the powers which have been granted to the director by this chapter. The hearing examiner’s decision shall be final. (h) The hearing examiner shall distribute a written decision to the director within fifteen business days. (i) The department shall distribute a copy of the hearing examiner’s decision to the appellant within five business days of receiving the decision. (j) In the event the hearing examiner determines that there is a flaw in the impact fee program, that a specific exemption per Section 21.03.030(c) should be awarded on a consistent basis, or that the principles of fairness require amendments to this chapter, the hearing examiner may COML Council Packet 11-14-23, Page 47 of 277 advise the council as to any question or questions that the hearing examiner believes should be reviewed as part of the council’s review of the fee schedule as provided by Section 21.03.130. (k) The hearing examiner’s final decision is subject to appeal to the Superior Court of the state of Washington, Grant County, pursuant to the rules and regulations set forth in the Land Use Petition Act, Chapter 36.70C RCW. Section 2. This ordinance shall take effect and be in force five (5) days after its passage and publication of its summary as provided by law. Adopted by the City Council of the City of Moses Lake, WA and signed by its Mayor on November 14, 2023. _____________________________________ Don Myers, Mayor ATTEST: _______________________________________ Debbie Burke, City Clerk APPROVED AS TO FORM: _______________________________________ Katherine L. Kenison, City Attorney Martinez Swartz Myers Fancher Madewell Eck Skaug Vote: Date Published: November 20, 2023 Date Effective: November 25, 2023 COML Council Packet 11-14-23, Page 48 of 277 Council Staff Report To:Agenda Item Number: From Department For Agenda of:Proceeding Type Subject Reviewed and Approved by: Expenditure Required:Amount Budgeted:Appropriation Required: Action Requested Fiscal and Policy Implications Approve, Authorize, or Adopt: Provide Amended Direction: Mayor and City Council 13101 Kevin Fuhr, City Manager Administration 11/14/2023 Consent Agenda Surplus of the Moses Lake Municipal Airport City Manager City Attorney Community Development Finance Fire Human Resources Parks, Rec, & Cultural Services Police Public Works Technology Services 0.00$0.00$0.00$ Staff requests authorization to surplus the Moses Lake Municipal Airport and work on finding a new owner for the airport. Packet Attachments (if any) ML Municipal Airport Property Appraisal, Draft Resolution, and Aerial Picture of Property Overview After contracting with CBRE to appraise the ML Municipal Airport property, the report was received stating that the ML Municipal Airport is valued at $3,950,000. The original appraisal included the property south of the Moses Lake Operations Buildings, which in the report is referred to as Parcel 41. Parcel 41 has since been removed from the ML Municipal Airport to be used as future water storage/treatment. The ML Municipal Airport, minus Parcel 41, is valued at $2,660,000. Staff requests authorization to surplus the ML Municipal Airport property and begin looking for a new owner. The ultimate goal is to find another government entity to take possession of the airport. Possible budget revenue of $2,660,000, unless transferred to another government entity. Options and Results Approve the authorization and allow staff to look for a new owner. Staff will bring back options for recommended changes. COML Council Packet 11-14-23, Page 49 of 277 No Action Taken: Keep the ML Municipal Airport. COML Council Packet 11-14-23, Page 50 of 277 MOSES LAKE MUNICIPAL AIRPORT 3540 MUNICIPAL AIRPORT RD NE MOSES LAKE, WASHINGTON 98837 CBRE FILE NO. CB23US061656-2 EFFECTIVE DATE OF APPRAISAL: AUGUST 14, 2023 CLIENT: CITY OF MOSES LAKE APPRAISAL REPO RT CBRE VALUATION & ADVISORY SERVICES COML Council Packet 11-14-23, Page 51 of 277 © 2023 CBRE, Inc. VALUATION & ADVISORY SERVICES 1420 Fifth Avenue, Suite 3800 Seattle, WA 98101 S.Murray Brackett, MAIDirector T (206) 292-6122 F (206) 292-1601 www.cbre.com Date of Report: October 27, 2023 Mr. Rich Huebner Assistant City Manager CITY OF MOSES LAKE 401 S. Balsam Street Moses Lake, Washington 98837 RE: Moses Lake Municipal Airport Land Evaluation 3540 Municipal Airport Rd NE Moses Lake, Washington Dear Mr. Huebner: At your request and authorization, CBRE, Inc. has prepared an appraisal of the Moses Lake Airport property under two scenarios. The assignment is intended to assist the City with decision making regarding future uses of the Airport and Airport property. We have been requested to evaluate the property under two scenarios, as follows: Scenario One: Valuation of the Airport Property to a third party user, assuming a restriction to airport use is in place. Scenario Two: Valuation of the Airport Property to a third party, assuming no airport restriction is in place and rezone to Light Industrial use was pursued. Our analyses will reflect market value of the referenced property. The subject property consists of a 90.78-acre (2,374,020 sq. ft.) tract of land located at 3540 Municipal Airport Rd NE in Moses Lake, Washington. The two Scenarios are discussed in the Highest and Best Use section of the report, followed by a more detailed valuation section for the Scenario deemed to represent Highest and Best Use. Based on the analysis contained in the following report, our conclusions of value for the subject are as follows: SUMMARY OF CONCLUSION Appraisal Premise As of Date Value Conclusion Fee Simple August 14, 2023 3,950,000 (Light Ind. Potential) Compiled by CBRE COML Council Packet 11-14-23, Page 52 of 277 October 27, 2023 Page 2 © 2023 CBRE, Inc. The report, in its entirety, including all assumptions and limiting conditions, is an integral part of, and inseparable from, this letter. The following appraisal sets forth the most pertinent data gathered, the techniques employed, and the reasoning leading to the opinion of value. The analyses, opinions and conclusions were developed based on, and this report has been prepared in conformance with, the guidelines and recommendations set forth in the Uniform Standards of Professional Appraisal Practice (USPAP), and the requirements of the Code of Professional Ethics and Standards of Professional Appraisal Practice of the Appraisal Institute. The intended use and user of our report are specifically identified in our report as agreed upon in our contract for services and/or reliance language found in the report. As a condition to being granted the status of an intended user, any intended user who has not entered into a written agreement with CBRE in connection with its use of our report agrees to be bound by the terms and conditions of the agreement between CBRE and the client who ordered the report. No other use or user of the report is permitted by any other party for any other purpose. Dissemination of this report by any party to any non-intended users does not extend reliance to any such party, and CBRE will not be responsible for any unauthorized use of or reliance upon the report, its conclusions or contents (or any portion thereof). It has been a pleasure to assist you in this assignment. If you have any questions concerning the analysis, or if CBRE can be of further service, please contact us. Respectfully submitted, CBRE - VALUATION & ADVISORY SERVICES S.Murray Brackett, MAI Phone: 206-595-1068 Fax: (206) 292-1601 Email: murray.brackett@cbre.com COML Council Packet 11-14-23, Page 53 of 277 Certification i CB23US061656-2© 2023 CBRE, Inc. Certification We certify to the best of our knowledge and belief: 1.The statements of fact contained in this report are true and correct. 2.The reported analyses, opinions, and conclusions are limited only by the reported assumptions and limiting conditions and are our personal, impartial and unbiased professional analyses, opinions, and conclusions. 3.We have no present or prospective interest in or bias with respect to the property that is the subject of this report and have no personal interest in or bias with respect to the parties involved with this assignment. 4.Our engagement in this assignment was not contingent upon developing or reporting predetermined results. 5.Our compensation for completing this assignment is not contingent upon the development or reporting of a predetermined value or direction in value that favors the cause of the client, the amount of the value opinion, the attainment of a stipulated result, or the occurrence of a subsequent event directly related to the intended use of this appraisal. 6.Our analyses, opinions, and conclusions were developed, and this report has been prepared, in conformity with the Uniform Standards of Professional Appraisal Practice, as well as the requirements of the State of Washington. 7.The reported analyses, opinions, and conclusions were developed, and this report has been prepared, in conformity with the requirements of the Code of Professional Ethics and Standards of Professional Appraisal Practice of the Appraisal Institute. 8.The use of this report is subject to the requirements of the Appraisal Institute relating to review by its duly authorized representatives. 9.As of the date of this report, S. Murray Brackett, MAI has completed the continuing education program for Designated Members of the Appraisal Institute. 10. S. Murray Brackett, MAI has made a personal inspection of the property that is the subject of this report. 11. No one provided significant real property appraisal assistance to the persons signing this report. 12. Valuation & Advisory Services operates as an independent economic entity within CBRE, Inc. Although employees of other CBRE, Inc. divisions may be contacted as a part of our routine market research investigations, absolute client confidentiality and privacy were maintained at all times with regard to this assignment without conflict of interest. 13. S. Murray Brackett, MAI has recently provided an appraisal of market rent for the existing lots at the subject airport, under the premise of continued aviation use. Aside from this the appraiser has not provided any valuation services regarding the property that is the subject of this report within the three-year period immediately preceding agreement to perform this assignment. S.Murray Brackett, MAI Appraiser License: 1100853 COML Council Packet 11-14-23, Page 54 of 277 Subject Photographs ii CB23US061656-2© 2023 CBRE, Inc. Subject Photographs Aerial View – COML Council Packet 11-14-23, Page 55 of 277 Subject Photographs iii CB23US061656-2© 2023 CBRE, Inc. Subject Photographs 1.View of the northwest portion of the airport from the east side. 2.Looking southwest from the northeast portion of the airport. 3.Typical view of the east side of the airport. 4.West side view at the south end of the airport. 5.Typical view of the east side.6.Looking westerly from the southeast portion of the airport. COML Council Packet 11-14-23, Page 56 of 277 Subject Photographs iv CB23US061656-2© 2023 CBRE, Inc. Subject Photographs 7.West side, looking northerly 8.View towards the 25-acre undeveloped area at the southwest. 9. Another view of the southwest acreage.. COML Council Packet 11-14-23, Page 57 of 277 Executive Summary v CB23US061656-2© 2023 CBRE, Inc. Executive Summary Property Name Location Parcel Number(s) Client Highest and Best Use As If Vacant As Improved Property Rights Appraised Date of Inspection Estimated Exposure Time Primary Land Area 90.78 acres (incl runway/road) Zoning Existing Alternative Use Compiled by CBRE Light Industrial Anticipated Moses Lake Municipal Airport August 14, 2023 N/A - Analysis is land only Industrial Use - per Alternative Use Scenario 3540 Municipal Airport Rd NE Moses Lake, Grant County, WA 98837 City of Moses Lake 110484101 et. al. Fee Simple 12-18 months (for Alternative Use) Municipal Airport Zone SUMMARY OF CONCLUSION Appraisal Premise As of Date Value Conclusion Fee Simple August 14, 2023 3,950,000 (Light Ind. Potential) Compiled by CBRE STRENGTHS, WEAKNESSES, OPPORTUNITIES AND THREATS (SWOT) Strengths/ Opportunities •Site is large with utility services available. •Site is well located in the Moses Lake area. Weaknesses/ Threats •There is considerable available land in Grant County and surrounding counties, which provide competition and downward pressure on pricing. COML Council Packet 11-14-23, Page 58 of 277 Executive Summary vi CB23US061656-2© 2023 CBRE, Inc. MARKET VOLATILITY We draw your attention to a combination of inflationary pressures (leading to higher interest rates) and recent failures/stress in banking systems which have significantly increased the potential for constrained credit markets, negative capital value movements and enhanced volatility in property markets over the short-to-medium term. Experience has shown that consumer and investor behavior can quickly change during periods of such heightened volatility. Lending or investment decisions should reflect this heightened level of volatility and the potential for deteriorating market conditions. It is important to note that the conclusions set out in this report are valid as at the valuation date only. Where appropriate, we recommend that the valuation is closely monitored, as we continue to track how markets respond to evolving events. CURRENT ECONOMIC CONDITIONS At its September 2023 meeting, the Federal Reserve held the federal funds rate at a range of 5.25% to 5.50% as expected. Additionally, the Fed affirmed that balance sheet reductions would continue as planned. Compared with its earlier outlook for 2023, the Fed now expects stronger GDP growth (2.1% vs 1.0% previously), lower unemployment (3.8% vs. 4.1%), modestly higher headline inflation (3.3% vs. 3.2%) and lower core inflation (3.7% vs. 3.9%) at year-end. Although the labor market remains tight, average monthly job growth has slowed to 150,000 over the past three months from 312,000 in Q1 2023 and 400,000 in Q4 2022. Additionally, core inflation is up by just 2.4% on an annualized basis over the past three months. We expect the downward trend in core inflation to continue as the core Producer Price Index has fallen below 2.0% and consumer spending is likely to weaken as excess savings are depleted. While opinions vary on future economic issues, the general market consensus at the time of this appraisal is the anticipation of moderating inflation as higher interest rates cool demand. Tighter lending conditions and a weakening economy will keep capital markets activity subdued and reduce leasing demand in the short to medium term. Amid this uncertain and dynamic environment, investment market performance will be uneven across property types. EXTRAORDINARY ASSUMPTIONS An extraordinary assumption is defined as “an assignment-specific assumption as of the effective date regarding uncertain information used in an analysis which, if found to be false, could alter the appraiser’s opinions or conclusions.” 1 We have been provided no information regarding the presence or absence of hazardous waste on the subject property. This report assumes the absence of any and all hazardous waste on the 1 The Appraisal Foundation, USPAP, 2020-2021 (Effective January 1, 2020 through December 31, 2023) COML Council Packet 11-14-23, Page 59 of 277 Executive Summary vii CB23US061656-2© 2023 CBRE, Inc. subject property. If hazardous waste is found to be present on the subject property, we reserve the right to change the conclusions contained in this report. This appraisal incorporates the following Extraordinary Assumptions: 1. The Alternative use analysis (Scenario Two) assumes all sites are vacant; 2.Both Scenario reflect land only; 3. The conclusions reflect parcels with access to public services. At the present time the east side of the airport does not have sewer extended however it is assumed to be available to the serve the property in both scenarios. 4.Zoning for Scenario Two – our analysis assumes that a typical buyer would be able to achieve a rezone to Light Industrial within 6 months. Our analysis does not reflect potential delays or unforeseen issues associated with closing the existing Airport operation. HYPOTHETICAL CONDITIONS A hypothetical condition is defined as “a condition, directly related to a specific assignment, which is contrary to what is known by the appraiser to exist on the effective date of the assignment results but is used for the purposes of analysis.” 2 •None. OWNERSHIP AND PROPERTY HISTORY The subject is owned by the municipality of the City of Moses Lake. The airport property was deeded to the City in 1947 by the Northern Pacific Railroad. Since 1994, operations at the Municipal Airport have been overseen by the Municipal Airport Advisory Board. CBRE is unaware of any arm’s length ownership transfers of the property within three years of the date of appraisal. Further, the property is not reportedly being offered for sale as of the current date. EXPOSURE TIME Regarding Scenario One, Sales of municipal airports are extremely rare and may reflect alternative uses. Scenario One presumes the requirement to maintain airport operations runs with the land. Such a requirement is expected to require an extended Exposure period. We have researched the market for such data and have identified little direct evidence for exposure periods with such restrictions. Based on our experience and observations of the marketing of aviation facilities, we anticipate an exposure period of up to three years may be required for Scenario One. 2 The Appraisal Foundation, USPAP, 2020-2021 (Effective January 1, 2020 through December 31, 2023) COML Council Packet 11-14-23, Page 60 of 277 Executive Summary viii CB23US061656-2© 2023 CBRE, Inc. Regarding Scenario Two, the presumption is that a rezone to Light Industrial would be forthcoming within a reasonable period of time (6 months). With this in mind, and reviewing exposure periods for our sales data, we anticipate an exposure period of 12-18 months under Scenario Two. COML Council Packet 11-14-23, Page 61 of 277 Table of Contents ix CB23US061656-2© 2023 CBRE, Inc. Table of Contents Certification ........................................................................................................................... i Subject Photographs .............................................................................................................. ii Executive Summary................................................................................................................. v Table of Contents .................................................................................................................. ix Scope of Work ....................................................................................................................... 1 Area Analysis ........................................................................................................................ 6 Neighborhood Analysis ......................................................................................................... 8 Zoning................................................................................................................................. 16 Tax and Assessment Data .................................................................................................... 21 Market Analysis ................................................................................................................... 22 Highest and Best Use .......................................................................................................... 27 Valuation Methodology ....................................................................................................... 31 Summary of Conclusions ..................................................................................................... 36 Assumptions and Limiting Conditions .................................................................................. 36 ADDENDA A Land Sale Data Sheets Industrial B Qualifications COML Council Packet 11-14-23, Page 62 of 277 Scope of Work 1 CB23US061656-2© 2023 CBRE, Inc. Scope of Work This Appraisal Report is intended to comply with the real property appraisal development and reporting requirements set forth under Standards Rule 1 and 2 of USPAP. The scope of the assignment relates to the extent and manner in which research is conducted, data is gathered, and analysis is applied. The scope of this appraisal considers land values in the area surrounding Moses Lake Municipal Airport, which have generally similar characteristics. We have also considered land sales in the greater Grant County area, and surrounding counties, as appropriate. In appraising the subject property, the appraisers did the following: •Researched CBA and CoStar for land sales activity. •Researched CBRE’s existing database. •Confirmed all land sales with buyers, selling agents, Costar services and/or public records. •Developed appropriate valuation criteria/techniques based upon Appraiser experience and interviews with real estate professionals. INTENDED USE OF REPORT The purpose of the report is to establish opinions of value for the entire airport site under two scenarios for use by the City. INTENDED USER OF REPORT This appraisal is to be used by City of Moses Lake. No other user(s) may rely on our report unless as specifically indicated in this report. Intended users are those who an appraiser intends will use the appraisal or review report. In other words, appraisers acknowledge at the outset of the assignment that they are developing their expert opinions for the use of the intended users they identify. Although the client provides information about the parties who may be intended users, ultimately it is the appraiser who decides who they are. This is an important point to be clear about: The client does not tell the appraiser who the intended users will be. Rather, the client tells the appraiser who the client needs the report to be speaking to, and given that information, the appraiser identifies the intended user or users. It is important to identify intended users because an appraiser’s primary responsibility regarding the use of the report’s opinions and conclusions is to those users. Intended users are those parties to whom an appraiser is responsible for communicating the findings in a clear and understandable manner. They are the audience. 3 3 Appraisal Institute, The Appraisal of Real Estate, 15th ed. (Chicago: Appraisal Institute, 2020), 40. COML Council Packet 11-14-23, Page 63 of 277 Scope of Work 2 CB23US061656-2© 2023 CBRE, Inc. RELIANCE LANGUAGE Reliance on any reports produced by CBRE under this Agreement is extended solely to parties and entities expressly acknowledged in a signed writing by CBRE as Intended Users of the respective reports, provided that any conditions to such acknowledgement required by CBRE or hereunder have been satisfied. Parties or entities other than Intended Users who obtain a copy of the report or any portion thereof (including Client if it is not named as an Intended User), whether as a result of its direct dissemination or by any other means, may not rely upon any opinions or conclusions contained in the report or such portions thereof, and CBRE will not be responsible for any unpermitted use of the report, its conclusions or contents or have any liability in connection therewith. PURPOSE OF THE APPRAISAL The purpose of this appraisal is to provide an “Alternative Use” analysis of the overall site, for internal use. DEFINITION OF VALUE We have prepared an opinion of Market Value for this assignment. The current economic definition of market value agreed upon by agencies that regulate federal financial institutions in the U.S. (and used herein) is as follows: The most probable price which a property should bring in a competitive and open market under all conditions requisite to a fair sale, the buyer and seller each acting prudently and knowledgeably, and assuming the price is not affected by undue stimulus. Implicit in this definition is the consummation of a sale as of a specified date and the passing of title from seller to buyer under conditions whereby: 1.buyer and seller are typically motivated; 2.both parties are well informed or well advised, and acting in what they consider their own best interests; 3.a reasonable time is allowed for exposure in the open market; 4.payment is made in terms of cash in U.S. dollars or in terms of financial arrangements comparable thereto; and 5. the price represents the normal consideration for the property sold unaffected by special or creative financing or sales concessions granted by anyone associated with the sale. 4 INTEREST APPRAISED The value estimated represents Fee Simple Estate as defined below: Fee Simple Estate - Absolute ownership unencumbered by any other interest or estate, subject only to the limitations imposed by the governmental powers of taxation, eminent domain, police power and escheat.. 4 Interagency Appraisal and Evaluation Guidelines; December 10, 2010, Federal Register, Volume 75 Number 237, Page 77472. COML Council Packet 11-14-23, Page 64 of 277 Scope of Work 3 CB23US061656-2© 2023 CBRE, Inc. Extent to Which the Property is Identified The property is identified through the following sources: -postal address -assessor’s records - client provided mapping Extent to Which the Property is Inspected S.Murray Brackett, MAI inspected the subject property and surrounding environs on August 14, 2023, the effective date of appraisal. This inspection was considered adequate and is the basis for our findings. Type and Extent of the Data Researched CBRE reviewed the following: -applicable tax data -zoning requirements - flood zone status -demographics - comparable sales data Type and Extent of Analysis Applied CBRE, Inc. analyzed the data gathered through the use of appropriate and accepted appraisal methodology to arrive at a probable value indication via each applicable approach to value. For vacant land, the Sales Comparison approach has been employed for this assignment. STATEMENT OF COMPETENCY S.Murray Brackett, MAI has the appropriate knowledge, education and experience to complete this assignment competently. COML Council Packet 11-14-23, Page 65 of 277 Scope of Work 4 CB23US061656-2© 2023 CBRE, Inc. Data Resources Utilized in the Analysis DATA SOURCES Item:Source(s): Site Data Size Client, County Excess/Surplus None Improved Data N/A Other Zoning City of Moses Lake Code Flood, Environment FEMA, City of Moses Lake Land Sales Comparables CoStar, CBA, CBRE proprietary database, Market Participants Data Not Provided Item 1 Title report Compiled by CBRE APPRAISAL METHODOLOGY In appraisal practice, an approach to value is included or omitted based on its applicability to the property type being valued and the quality and quantity of information available. Depending on a specific appraisal assignment, any of the following four methods may typically be used to derive a market value opinion for the fee simple interest of land: •Sales Comparison Approach; •Income Capitalization Procedures; •Allocation; and •Extraction. The following summaries of each method are paraphrased from Appraisal texts. We note that underlying land value is one component used in our analysis of an appropriate market rent. The first is the Sales Comparison approach. This is a process of analyzing sales of similar, recently sold parcels in order to derive an indication of the most probable sales price (or value) of the property being appraised. The reliability of this approach is dependent upon (a) the availability of comparable sales data, (b) the verification of the sales data regarding size, price, terms of sale, etc., (c) the degree of comparability or extent of adjustment necessary for differences between the subject and the comparables, and (d) the absence of nontypical conditions affecting the sales price. This is the primary and most reliable method used to value land (if adequate data exists). The Income approach include three methods: land residual technique, ground rent capitalization, and Subdivision Development Analysis. A discussion of each of these three techniques is presented in the following paragraphs. The land residual method may be used to estimate land value when sales data on similar parcels of vacant land are lacking. This technique is based on the principle of balance and the related concept of contribution, which are concerned with equilibrium COML Council Packet 11-14-23, Page 66 of 277 Scope of Work 5 CB23US061656-2© 2023 CBRE, Inc. among the agents of production--i.e. labor, capital, coordination, and land. The land residual technique can be used to estimate land value when: 1) building value is known or can be accurately estimated, 2) stabilized, annual net operating income to the property is known or estimable, and 3) both building and land capitalization rates can be extracted from the market. Building value can be estimated for new or proposed buildings that represent the highest and best use of the property and have not yet incurred physical deterioration or functional obsolescence. The subdivision development method is used to value land when subdivision and development represent the highest and best use of the appraised parcel. In this method, an appraiser determines the number and size of lots that can be created from the appraised land physically, legally, and economically. The value of the underlying land is then estimated through a discounted cash flow analysis with revenues based on the achievable sale price of the finished product and expenses based on all costs required to complete and sell the finished product. The ground rent capitalization procedure is predicated upon the assumption that ground rents can be capitalized at an appropriate rate to indicate the market value of a site. Ground rent is paid for the right to use and occupy the land according to the terms of the ground lease; it corresponds to the value of the landowner's interest in the land. Market-derived capitalization rates are used to convert ground rent into market value. This procedure is useful when an analysis of comparable sales of leased land indicates a range of rents and reasonable support for capitalization rates can be obtained. The Allocation method is typically used when sales are so rare that the value cannot be estimated by direct comparison. This method is based on the principle of balance and the related concept of contribution, which affirm that there is a normal or typical ratio of land value to property value for specific categories of real estate in specific locations. This ratio is generally more reliable when the subject property includes relatively new improvements. The allocation method does not produce conclusive value indications, but it can be used to establish land value when the number of vacant land sales is inadequate. The Extraction method is a variant of the allocation method in which land value is extracted from the sale price of an improved property by deducting the contribution of the improvements, which is estimated from their depreciated costs. The remaining value represents the value of the land. Value indications derived in this way are generally unpersuasive because the assessment ratios may be unreliable and the extraction method does not reflect market considerations. For the purposes of this analysis, we have utilized the Sales Comparison approach, as it is the most appropriate method for the subject. COML Council Packet 11-14-23, Page 67 of 277 Area Analysis 6 CB23US061656-2© 2023 CBRE, Inc. Area Analysis POPULATION Source: ESRI, downloaded on Oct, 4 2023 The subject is located in the Moses Lake,WA Micropolitan Statistical Area. Key information about the area is provided in the following tables. The area has a population of 102,540 and a median age of 35,with the largest population group in the 0-9 age range and the smallest population in 80+ age range. Population has increased by 13,420 since 2010,reflecting an annual increase of 1.1%. Population is projected to increase by 2,858 between 2023 and 2028,reflecting a 0.6% annual population growth. 89,120 102,540 105,398 0 20,000 40,000 60,000 80,000 100,000 120,000 2010 2023 2028 POPULATION BY YEAR 0 5,000 10,000 15,000 20,000 0-9 10-19 20-29 30-39 40-49 50-59 60-69 70-79 80+ AREA POPULATION BY AGE Source: Esri Source: Esri COML Council Packet 11-14-23, Page 68 of 277 Area Analysis 7 CB23US061656-2© 2023 CBRE, Inc. INCOME EDUCATION EMPLOYMENT Source: ESRI, downloaded on Oct 4, 2023; BLS.gov dated Jan 0, 1900 The area includes a total of 49,693 employees.The top three industries within the area are Agric/Forestry/Fishing/Hunting, Manufacturing and Health Care/Social Assistance,which represent a combined total of 45% of the workforce. The area features an average household income of $92,668 and a median household income of $62,841. Over the next five years, median household income is expected to increase by 15.0%, or $1,891 per annum. A total of 20.2%of individuals over the age of 24 have a college degree,with 14.5%holding a bachelor's degree and 5.7%holding a graduate degree. $62,841 $72,297 $0 $20,000 $40,000 $60,000 $80,000 2023 2028 MEDIAN INCOME BY YEAR 14.5%5.7% 79.8% POPULATION BY DEGREE Bachelor's Degree Graduate Degree Other 0%5%10%15%20%25% Prof/Scientific/Tech Services Construction Accommodation/Food Services Public Administration Transportation/Warehousing Retail Trade Educational Services Health Care/Social Assistance Manufacturing Agric/Forestry/Fishing/Hunting Source: Esri Source: Esri Source: Esri In summary, the area is forecasted to experience an increase in population and an increase in household income. COML Council Packet 11-14-23, Page 69 of 277 Neighborhood Analysis 8 CB23US061656-2© 2023 CBRE, Inc. Neighborhood Analysis LOCATION The subject is in the Moses Lake area of Grant County. Moses Lake is Grant County’s most populous city in Grant County and is situated along Interstate 90, Washington’s main east west freeway, which travels from the Washington/Idaho border to Seattle. The subject property is COML Council Packet 11-14-23, Page 70 of 277 Neighborhood Analysis 9 CB23US061656-2© 2023 CBRE, Inc. south of the Grant County International airport, approximately 2 ¾ miles north of Interstate 90, and one mile east of State Route 17. BOUNDARIES The neighborhood boundaries are detailed as follows: North: Road 5.6 N South: Interstate 90 East: Road N 9 NE West: Downtown Moses Lake LAND USE Land uses within the subject neighborhood consist of primarily aviation, residential, and agricultural development. However, a significant feature in the area is the Grant County International Airport, which boasts one of the largest airfields in the United States and can accept the largest aircraft in the world. The airport is a facility favored by military and commercial flight test programs. It has capacity to accommodate much more given its existing runways and onsite FAA control tower for commercial, military, and general aviation use. Grant County has an aerospace history dating back to the late 1940’s when the Larson Airforce Base was established. The Larsen Airforce bases operated until 1966 when it was announced that it would close. The community voted to create the Port of Moses Lake and the Larsen Airforce Base was granted to the Port and became Grant County International Airport. Today, Boeing, along with many other flight test companies, such as Aviation Technical Services, Sonico, and AeroTEC, use the Grant County International Airport for ongoing aviation tests and training. More recently the technology industry has developed over 1.5 million square feet of data centers in Grant County. The low cost of electricity, the open land, and the fiber optic network have attracted software companies such as Dell, Yahoo!, and Microsoft. According to the Port of Quincy, Microsoft has purchased approximately 275 acres of land in Grant County since 2005, followed by Dell with 82.5 acres and Vantage with 68 acres. The inflex of the technology industry has led to positive employment growth since 2010. The newest proposed development (Moses Lake Commerce Center) is situated closer to the Grant County airport and will include Industrial 4-5 single or multi-tenant industrial buildings, over 18 acres of land. Other land uses within the subject neighborhood consist of commercial development which is centered around SR-17, Pioneer Way, Maiers Road, and Interstate 90. As you move to the southwest of the subject residential development begins and becomes denser as you move towards the shores of Moses Lake. COML Council Packet 11-14-23, Page 71 of 277 Neighborhood Analysis 10 CB23US061656-2© 2023 CBRE, Inc. GROWTH PATTERNS The most recent growth within the subject neighborhood has occurred to the south and west along Maiers Road and Yonezawa Boulevard. This area has seen the development of a new Fairfield Inn Hotel as well as an additional hotel that was constructed in 2007. Additional recent development includes a 2008-built Lowes Home Improvement Store as well as a 2016-built Denny’s restaurant. When Denny’s moved to their new location in 2016 their former location to the south of the subject was remodeled into a Carl’s Jr. restaurant. Most notably, WinCo grocery opened its first location in Moses Lake earlier in 2017. Wal-Mart, which is located east of the WinCo, opened its only Moses Lake location in 2008, and is the primary demand generator within the neighborhood. The retail corridor to the south of the Highway 17/Stratford Road interchange has generally benefited from the presence of Wal-Mart as well as several other national retailers. There has also been a moderate amount of residential growth within the neighborhood. New development includes the 129-unit Central Park Villas apartments that was completed in 2017; the 228-unit Solara Apartments completed in early 2018; the Pioneer Meadows apartments that consists of 181 units and was completed in 2018. ACCESS Regional access is primarily served by Interstate 90, which connects with Seattle to the west and Spokane to the northeast. Within the subject neighborhood, local access is primarily served by State Route 17 (a.k.a. S. Pioneer Way) and Moses Lake-Strattford Road. State Route 17, west of the subject is a commercial corridor through Moses Lake and has an interchange with Interstate 90. The primary east-west arterial within the subject neighborhood is Wheeler Road. In addition to the arterials, numerous collector streets interconnect the surrounding neighborhoods. DEMOGRAPHICS Selected neighborhood demographics in 1-, 3- and 5-mile radius from the subject are shown in the following table: COML Council Packet 11-14-23, Page 72 of 277 Neighborhood Analysis 11 CB23US061656-2© 2023 CBRE, Inc. 3540 Municipal Airport Rd NE Moses Lake, WA 98837 Population 2028 Total Population 719 21,042 39,126 8,196,106 105,398 105,398 2023 Total Population 718 20,380 38,071 7,962,223 102,540 102,540 2010 Total Population 500 16,207 31,909 6,724,540 89,120 89,120 2000 Total Population 332 12,963 26,270 5,894,121 74,698 74,698 Annual Growth 2023 - 2028 0.03% 0.64% 0.55%0.58%0.55%0.55% Annual Growth 2010 - 2023 2.82% 1.78% 1.37%1.31%1.08%1.08% Annual Growth 2000 - 2010 4.18% 2.26% 1.96%1.33%1.78%1.78% Households 2028 Total Households 263 8,094 14,552 3,199,453 36,602 36,602 2023 Total Households 260 7,802 14,076 3,089,990 35,420 35,420 2010 Total Households 172 5,978 11,449 2,620,076 30,041 30,041 2000 Total Households 110 4,754 9,294 2,271,398 25,204 25,204 Annual Growth 2023 - 2028 0.23% 0.74% 0.67%0.70%0.66%0.66% Annual Growth 2010 - 2023 3.23% 2.07% 1.60%1.28%1.28%1.28% Annual Growth 2000 - 2010 4.57% 2.32% 2.11%1.44%1.77%1.77% Income 2023 Median Household Income $95,439 $59,803 $59,525 $89,067 $62,841 $62,841 2023 Average Household Income $126,531 $90,772 $88,091 $128,120 $92,668 $92,668 2023 Per Capita Income $45,266 $34,320 $32,485 $49,813 $32,040 $32,040 2023 Pop 25+ College Graduates 159 3,365 5,438 2,231,047 13,164 13,164 Age 25+ Percent College Graduates - 2023 33.1% 26.0% 22.7%40.1%20.2%20.2% Source: ESRI SELECTED NEIGHBORHOOD DEMOGRAPHICS Washington Moses Lake, WA Micropolitan Statistical Area Grant County1 Mile Radius 3 Mile Radius 5 Mile Radius CONCLUSION The subject neighborhood is made up of commercial, aviation, industrial, and agricultural developments, with the immediate area near the subject land uses consisting primarily of agricultural land with some residential and industrial developments. Commercial and office and retail properties in the neighborhood are generally located along the major arterials in downtown Moses Lake. Average household income in the area is similar to the County overall, but well below the Washington state average. Households are forecast to grow modestly over the next five years. The population within the subject neighborhood has increased over the past five years and is projected to continue its growth over the next five years. Overall, the outlook for the neighborhood is considered positive. COML Council Packet 11-14-23, Page 73 of 277 Site Analysis 12 CB23US061656-2© 2023 CBRE, Inc. SITE PLAN MAP COML Council Packet 11-14-23, Page 74 of 277 Site Analysis 13 CB23US061656-2© 2023 CBRE, Inc. SITE ANALYSIS Description of Subject The site is situated at the northeast corner of the city of Moses Lake. It contains 90.78 acres with frontage on two roads, Cherokee Road on the north side, and Road L NE, on the east side. It is currently configured into 41 parcels of land associated with airport use. These are summarized below. Parcel ID Parcel # Site Size Ac. 110484101 1 0.66 110484102 2 0.55 110484103 3 0.6 110484104 4 0.68 110484105 5 0.45 110484106 6 0.32 110484107 7 0.31 110484108 8 0.3 110484109 9 0.29 110484110 10 0.59 110484111 11 0.32 110484112 12 0.34 110484113 13 0.35 110484114 14 0.35 110484115 15 0.46 110484116 16 0.41 110484117 17 0.48 110484118 18 0.63 110484119 19 0.6 110484120 20 0.75 110484121 21 0.75 110484123 23 0.5 110484124 24 0.5 110484125 25 0.5 110484126 26 0.5 110484127 27 0.5 110484128 28 0.5 110484129 29 1.64 110484130 30 1.16 110484131 31 0.5 110484132 32 0.5 110484133 33 0.5 110484134 34 0.5 110484135 35 0.5 110484136 36 0.5 110484137 37 0.5 110484138 38 0.51 110484139 39 0.43 110484140 40 0.49 110484140 41 69.86 Total 90.78 Source: Grant County Assessor's Mapsifter and Assessor Records Moses Lake Municipal Airport COML Council Packet 11-14-23, Page 75 of 277 Site Analysis 14 CB23US061656-2© 2023 CBRE, Inc. We note that this analysis involves two scenarios, with the second being alternative use of the property. In this case it is not anticipated that the tax parcels above would necessarily remain in their existing configuration. This will be discussed further in the Highest and Best Use section. INGRESS/EGRESS The site’s main entrance is off Cherokee Road (aka) Road 4 NE, west of Road L NE. Interior areas are accessed via existing paved roads around the perimeter of the airport. UTILITIES All publicly available utilities are extended (or could be extended from Road 4 NE) to the property. TOPOGRAPHY The airport property is generally level throughout. In general, the conclusions in this report reflect leveled/graded sites that are ready for development. SOILS We were not provided with a soils report; however, according to the USDA web soil survey, the majority of the subject consists of Ephrata fine sandy loam, with 0 to 2 percent slopes. It is prime farmland if irrigated. It is well drained with more than 80 inches to the water table. The second soil type on the subject property is situated in the southwest area and is identified as Malaga gravelly sandy loam, with 0 to 5 percent slopes. It is not prime farmland, is somewhat excessively drained with a similar depth to water table. COML Council Packet 11-14-23, Page 76 of 277 Site Analysis 15 CB23US061656-2© 2023 CBRE, Inc. Site Analysis The following chart summarizes the salient characteristics of the subject site. SITE SUMMARY AND ANALYSIS Physical Description Gross Site Area 90.78 Acres 3,954,377 Sq. Ft. Primary Road Frontage Cherokee Rd (Rd4)1,700 Feet Secondary Road Frontage Municipal Airport Road 2,500 Feet Additional Road Frontage Municipal Hangar Road 2,500 Feet Average Depth 2,500 Feet Excess Land Area None n/a Surplus Land Area None n/a Shape Topography Parcel Number(s) Zoning District Flood Map Panel No. & Date 53025C1310C 18-Feb-09 Flood Zone Zone X (Unshaded) Adjacent Land Uses Earthquake Zone Utilities Availability Water Yes Sewer Yes Electricity Yes Telephone Yes Various sources compiled by CBRE Irregular Generally Level Municipal Airport Zone n/a Industrial, agricultural 110484101 et. al. 41 parcels in total at the subject property Comments Assumed to East side COML Council Packet 11-14-23, Page 77 of 277 Site Analysis 16 CB23US061656-2© 2023 CBRE, Inc. Zoning The following chart summarizes the subject’s zoning requirements. ZONING SUMMARY Scenario 1- Existing Zoning Municipal Airport Zone Scenario 2 - Assumed Zoning Light Industrial Uses Permitted Runways,taxiways, navigational equipment, aircraft parking areas and other facilities and features normally associated with a general aviation airport. Aircraft sales,repair, rebuild, maintenance service and storage,and the facilities essential important to their operation. Schools related to aircraft and flight operations and the facilities essential for or important to their operation.Hangars intended for the storage of aircraft.Fixed base operations providing aviation and aircraft services to the general public.Storage and sale of aviation fuel,oil,and other fluids commonly used in aircraft.Air terminal facilities including those used for both cargo and passengers.Public and semi-public buildings,structures,and uses essential to the welfare of the City of Moses Lake such as a fire station,pump station,and water storage. Farming. Aircraft dismantling business.Retail grocery stores and restaurants. Permitted medical uses including structure used to provide first aid and/or medical stabilization necessary prior to air evacuation and facilities necessary for the staging of helicoter and fixed- wing air ambulance aircraft. Assembly of parts,bus barn/maintenance,machine shop, manufacturing of previously prepared materials,manufacturing food products, printing/publishing,recycling,storage/warehouse, tech labs, transportation services,industrial agricultural services,welding,wrecking yards, accessory uses for construction,daycare,onsite security,and office.Animal shelter,lumber yard/contractor,government,industrial laundry, mini-storage,nurseries,vehicle repair, retail/wholesale of goods, towing. Zoning Requirements Municipal Airport Zone Light Industrial Minimum Lot Size None None Minimum Lot Width None None Maximum Height Varies 50' Minimum Setbacks Front Yard 15 Feet None Street Side Yard 15 Feet None Interior Side Yard 15 Feet None Rear Yard 0 Feet None Maximum Bldg. Coverage None None Parking Requirements 2 for every 3 employees Varies Source: Planning & Zoning Dept. PROPERTY UTILITY At most similar regional airports uses are general aviation in nature, with few alternative use categories. Some airports have business park components or even some retail components. The subject contains primarily general aviation use, and this is the standard we use for comparison with other facilities. Regarding Scenario Two, we have assumed that conversion to Light Industrial zoning would be reasonably probable, and this is the basis for our analysis (see extraordinary assumptions). COML Council Packet 11-14-23, Page 78 of 277 Site Analysis 17 CB23US061656-2© 2023 CBRE, Inc. EASEMENTS AND ENCROACHMENTS We have not been provided with a title report for the subject and are not aware of any easements or encroachments that would affect the highest and best use of the site. COVENANTS, CONDITIONS AND RESTRICTIONS AND AIRSPACE LIMITATIONS Scenario One The height restrictions contained in this section are in accordance with Federal Air Regulations Part 77 “Objects Affecting Navigable Airspace” and Federal Aviation Administration Advisory Circular 150/5300-13 “Airport Design”. The following is from the Moses Lake Municipal Code. 1.No structure or object except those whose placement is required for airport operations may be located within the Moses Lake Municipal Airport Object Free Area defined as a rectangle whose boundaries are three hundred feet (300') from the ends of the prepared runway surface and one hundred twenty-five feet (125') on both sides of the centerline of the runway. 2.No structure or object may be located so as to break the plane of a seven (7) to one (1) slope that begins at and extends outward at right angles from the edge of the Object Free Area. 3.No structure or object may be located closer than forty-five feet (45') from the center of any future taxiway as defined in the Airport Development Plan. 4. No structure or object may be located so as to penetrate the twenty (20) to one (1) approach departure surface extending from the edges of the Object Free Area at both ends of the runway The above discussion essentially provides height limitations over portions of the property. On the west side these limits do not appear to prohibit typical development. On the east side the lots are smaller and additional discussion is warranted. The 45’ setback from the taxiway centerline essentially requires that structures be located on the easterly portion of these parcels. In terms of height, it appears that adequate height is available for typical general aviation structures. Should particularly high-bay structures be contemplated at the airport, these would likely be sited on the west side due to the more stringent height limits on the east. Existing uses on the east side have been constructed with the height limitations in mind and appear to be consistent with typical general aviation structures. Aside from that described above we are aware of no known covenants, conditions or restrictions impacting the site that are considered to affect the marketability or use as an airport property. Scenario Two In Scenario Two the airport use is assumed closed and light industrial use would be pursued. As such we are aware of no covenants, conditions and restrictions that may impact value. It is recommended that a Title report be obtained prior to making any business decision. ENVIRONMENTAL ISSUES Although CBRE was not provided an Environmental Site Assessment (ESA), a tour of the site did not reveal any obvious issues regarding environmental contamination or adverse conditions. This report assumes none exist. COML Council Packet 11-14-23, Page 79 of 277 Site Analysis 18 CB23US061656-2© 2023 CBRE, Inc. The appraiser is not qualified to detect the existence of potentially hazardous material or underground storage tanks which may be present on or near the site. The existence of hazardous materials or underground storage tanks may affect the value of the property. For this appraisal, CBRE, Inc. has specifically assumed that the property is not affected by any hazardous materials that may be present on or near the property. ANALYSIS AND CONCLUSION For specific development questions additional information may be obtained from the appropriate governmental authority. For purposes of this appraisal, CBRE has assumed that all information obtained through public sources is correct. Regarding Scenario One, the current uses at the airport appear to be consistent with typical G.A. uses and the airport accommodates a variety of specific uses under this category. The east side sites are relatively small however are used by G.A. users as well, and oversize buildings may be limited by height restrictions. This is not considered to be a significant issue currently, given existing demand and probable use. Furthermore, east side uses requiring sewer service would be served by the City as necessary. With this in mind the airport is considered capable of supporting typical aviation uses. With respect to Scenario Two the property would consist of a large Light Industrial property and is assumed vacant. Roughly 25 acres (estimated) in the southwest corner is previously undeveloped, while the main area would be characterized as a former airport property. In this Scenario, Municipal Hangar Road extends several hundred feet south of Road 4 NE and is assumed to be Public. The east side of the property fronts on Road L, though a drainage canal intervenes. The current frontage road – Municipal airport road – appears to be part of the overall airport property and is considered to be part of the developable/usable land under this Scenario. Similarly, the runway becomes usable land in this Scenario. Access throughout the site would be accommodated as necessary for future use. As a large site however, the easterly road and runway are considered usable land for purposes of this analysis. COML Council Packet 11-14-23, Page 80 of 277 Site Analysis 19 CB23US061656-2© 2023 CBRE, Inc. With the above in mind the following chart summarizes the usable land area available under each Scenario: Moses Lake Municipal Airport Property - Usable Area Summary Scenario One Scenario Two Parcel ID Existing Parcel # Site Size (Gross SF) Site Size (Usable SF) Site Size (Usable SF) 110484101 1 28,750 28,750 28,750 110484102 2 23,958 23,958 23,958 110484103 3 26,136 26,136 26,136 110484104 4 29,621 29,621 29,621 110484105 5 19,602 19,602 19,602 110484106 6 13,939 13,939 13,939 110484107 7 13,504 13,504 13,504 110484108 8 13,068 13,068 13,068 110484109 9 12,632 12,632 12,632 110484110 10 25,700 25,700 25,700 110484111 11 13,939 13,939 13,939 110484112 12 14,810 14,810 14,810 110484113 13 15,246 15,246 15,246 110484114 14 15,246 15,246 15,246 110484115 15 20,038 20,038 20,038 110484116 16 17,860 17,860 17,860 110484117 17 20,909 20,909 20,909 110484118 18 27,443 27,443 27,443 110484119 19 26,136 26,136 26,136 110484120 20 32,670 32,670 32,670 110484121 21 32,670 32,670 32,670 110484123 23 21,780 21,780 21,780 110484124 24 21,780 21,780 21,780 110484125 25 21,780 21,780 21,780 110484126 26 21,780 21,780 21,780 110484127 27 21,780 21,780 21,780 110484128 28 21,780 21,780 21,780 110484129 29 71,438 71,438 71,438 110484130 30 50,530 50,530 50,530 110484131 31 21,780 21,780 21,780 110484132 32 21,780 21,780 21,780 110484133 33 21,780 21,780 21,780 110484134 34 21,780 21,780 21,780 110484135 35 21,780 21,780 21,780 110484136 36 21,780 21,780 21,780 110484137 37 21,780 21,780 21,780 110484138 38 22,216 22,216 22,216 110484139 39 18,731 18,731 18,731 110484140 40 21,344 21,344 21,344 Subtotal 911,275 911,275 911,275 110484140 41 3,043,102 1,089,000 3,043,102 Total 3,954,377 2,000,275 3,954,377 Source: Grant County Assessor's Mapsifter/Assessor Records/Appraiser Estimate COML Council Packet 11-14-23, Page 81 of 277 Site Analysis 20 CB23US061656-2© 2023 CBRE, Inc. As shown, the land available for lease, development and/or Sale under each Scenario is significantly impacted by the requirement to maintain the runway, taxiway and easterly road as currently configured. The lot sizes under Scenario One are small, while Scenario Two is not expected to benefit from the small existing parcel sizes due to the configuration and anticipated use as a large industrial site. This will be discussed in more detail in the highest and best use section. COML Council Packet 11-14-23, Page 82 of 277 Site Analysis 21 CB23US061656-2© 2023 CBRE, Inc. Tax and Assessment Data The subject property is owned by the City of Moses Lake and not subject to assessment or real property tax; however, airport lessees pay a 12.84% leasehold excise tax plus personal property taxes on privately-owned improvements. According to the Grant County Assessor, some other taxes do apply; Mosquito Control, Weed Tax and a Conservation tax, but these are considered minor, and totaled roughly $175 per parcel in 2023. For purposes of this analysis, CBRE, Inc. assumes that all taxes are current. Under private use the property taxes are assumed to be commensurate with surrounding industrial property. COML Council Packet 11-14-23, Page 83 of 277 Market Analysis 22 CB23US061656-2© 2023 CBRE, Inc. Market Analysis MOSES LAKE/GRANT COUNTY INDUSTRIAL MARKET OVERVIEW The following is an analysis of supply and demand trends in the Moses Lake and greater Grant County Industrial Market, using information provided by CoStar, widely recognized as a credible source for tracking market statistics. The table and charts below present historical data for key market indicators. The following map illustrates the industrial market, set by the Grant County boundaries using CoStar Analytics. Subject COML Council Packet 11-14-23, Page 84 of 277 Market Analysis 23 CB23US061656-2© 2023 CBRE, Inc. Market Snapshot Vacancy rates are extremely low at 0.4%. It is noteworthy that a Virginia-based investment management firm, has broken ground on Moses Lake Commerce Center, a 42-acre industrial development. The first phase is commencing with the construction of a 108,000-square-foot, temperature-controlled, food-grade processing facility on 10-acres. Full build out is expected to be over 1 million square feet. Similar to other commercial properties around the state, sales volumes are down, and marketing times have stretched out to nearly a year. Asking prices are higher per square foot but actual sales price differential is increasing at -13%. COML Council Packet 11-14-23, Page 85 of 277 Market Analysis 24 CB23US061656-2© 2023 CBRE, Inc. Market rents are forecast to continue a solid growth trajectory. And vacancy rates are expected to remain under 2% for the next five years. COML Council Packet 11-14-23, Page 86 of 277 Market Analysis 25 CB23US061656-2© 2023 CBRE, Inc. CAP RATE TRENDS Capitalization rates have been on the decline as a whole for the Puget Sound area Industrial market since the 2012 timeframe. As for the local economy, we researched the surrounding counties of Lincoln, Douglas, Adams, Franklin and Benton, as well as the subject’s Grant County. After a flat period during the Covid timeframe, cap rates have continued to fall in this area of the State, to roughly 5.5%. The area industrial market and the local submarket are exhibiting very strong occupancy levels and increasing rental rates, while maintaining positive absorption in recent quarters. Considering the recent trends in absorption and the continued demand for industrial space in the near term, the local market area is expected to exhibit strong growth in the near future. Comparison of Industrial Market to Aviation Market Historically, the market segment most often linked to Airport properties has been the Industrial market. Our analysis incorporates some data from this sector due to the comparatively similar property characteristics. Prior studies in the south Seattle marketplace suggest that land:building ratios (a proxy for intensity of use), can be lower on airport properties than off airport industrial COML Council Packet 11-14-23, Page 87 of 277 Market Analysis 26 CB23US061656-2© 2023 CBRE, Inc. properties, however both are lower than alternatives such as office use. The Seattle market is used only for relative analysis, as land values are significantly higher than the local market. Some of our data for the subsequent land value indications are drawn from the surrounding industrial market, and the comparative factors may suggest the need for an adjustment to the sales, particularly those that reflect a higher level of development intensity. The impact of this will be addressed in our land value analysis. COML Council Packet 11-14-23, Page 88 of 277 Highest and Best Use 27 CB23US061656-2© 2023 CBRE, Inc. Highest and Best Use In appraisal practice, the concept of highest and best use represents the premise upon which value is based. The four criteria the highest and best use must meet are: legally permissible; physically possible; financially feasible; and maximally productive. The highest and best use analysis of the subject is discussed below. It is important to note that our analysis reflects two Scenarios for the underlying land. Scenario One essentially evaluates the land based on the expectation of continued use as an airport, whereas Scenario Two anticipates a rezone to Light Industrial use. Neither Scenario reflects the potential business value associated with the Airport operation as many non-realty factors would need to be reflected in such an analysis. We have reviewed the historical revenue from the airport operation, which is effectively subsidized by the City. It is assumed that future use of the property under any scenario would reflect prudent management. AS VACANT Physical Possibility The land at Moses Lake Municipal is level, and utilities are either available or can be brought to specific locations. In addition, existing parcels are relatively small and suitable for individual hangar use as initially designed. The property is adequately served by roads and utilities. Thus, there are few physical constraints imposed by site characteristics. Because all of the sites are under common ownership by the City, our analysis reflects the highest and best use of the property as a whole. The following summarizes the usable land area under each Scenario. USABLE LAND AREA BY SCENARIONet Land Area (SF) Scenario One Small (Scen. 1)911,275 Large (Scen. 1)1,089,000 2,000,275 45.92 ac Scenario One Overall (Scen. 2)3,954,377 90.78 ac Compiled by CBRE COML Council Packet 11-14-23, Page 89 of 277 Highest and Best Use 28 CB23US061656-2© 2023 CBRE, Inc. Our analysis will focus specifically on the two Scenarios identified previously. As such Scenario One provides 911,275 square feet of land bordering the existing runway and subdivided into roughly ½ to 1-acre parcels. In addition, the southwest portion of the airport measures an estimated 25 acres that is available for development. The total usable land under Scenario One is therefore estimated at 45.92 acres. Scenario Two would be available for industrial development and therefore has no need for runways, taxiways, related setbacks and the easterly internal road. As a result, the entire 90.78 acres would be considered usable. Legal Permissibility Under Scenario One use of the subject as an airport supports and encourages airport-related developments. Height restrictions imposed by FAA regulations are adhered to but do not appear to be severely limiting, given the typical use. Our valuation analysis considers the effect of such height limitations. A height restriction applies to the airside property based on the edge of the taxiways, increasing at 7:1 moving away. To accommodate airport use, certain restrictions typically imposed by zoning regulations and building codes, such as building setbacks, may be less rigidly enforced since buildings will abut runways and taxiways. With regard to the properties specifically analyzed in this report, each has the potential for a wide range of development as if vacant. Dedicated use of the runway, taxiways and access road are necessary to facilitate use as an airport. Zoning (use) on a parcel-by-parcel basis is applied by the City of Moses Lake and is similar in intensity to light industrial zoning though more limited in terms of allowable uses. Under Scenario Two, the property would be able to accommodate large light industrial users over the entire property. As with any large site, future subdivision would be at the discretion of the property owner, subject to the feasibility in terms of added development costs, absorption and other factors. Financial Feasibility and Maximum Productivity Under Scenario One the land may be leased or (presumably) sold to users for aviation related use. Owners or users may construct new improvements or modify existing improvements. Our recent appraisal of the airport property for ground rent valuation purposes (incorporated by reference) concluded a land value for the small parcels to be $2.34/sf as an average. The 25- acre undeveloped tract was not evaluated as aviation land, however we refer the reader to the valuation section of this report for relevant comparable sales. Under Scenario One a broad view of the airport is necessary, one which considers the airport as a complete entity. Support services are typically necessary ranging from Tie down storage to aircraft service and/or manufacturing. The maintenance of the runway and taxiways is also a relevant discussion under a business value analysis, though this analysis presumes a runway in reasonable condition and no provision is made for specific runway maintenance. For purposes of determining highest and best use, we recognize that some variety and mix of aviation-related COML Council Packet 11-14-23, Page 90 of 277 Highest and Best Use 29 CB23US061656-2© 2023 CBRE, Inc. uses is likely necessary. In summary, the highest and best use of the airport property in total is intended to be reflected here. The contribution of the 25-acre parcel is concluded to be $1.25 per square foot based on our analysis of this sales data. Under Scenario Two the property would be considered by prospective buyers for large scale industrial operation or for potential subdivision. Analysis of any specific subdivision plan is beyond the scope of this appraisal. As a large tract the property would have competition in the immediate market area however tracts of this size with utilities are also attractive commodities in the current environment. Pricing would therefore be tempered somewhat by demand. In analyzing the property as industrial land, the various allowed uses may produce various financial returns. Demand for land in the immediate vicinity is reported as modest, however some market participants seek alternatives to the high-priced markets, and with respect to the airport, more affordable alternatives. Based on our analysis of the market and the sales presented in the following section, the unit price for the property as a large industrial site is concluded to be $1.00 per square foot. Conclusion of Highest and Best Use as Vacant The unit value indications above produce the following summary of conclusions for each Scenario. SUMMARY OF CONCLUSIONS BY SCENARIO Net Land Area (SF) Unit Price ($/sf)Extended Total of Scenario Scenario One Small (Scen. 1)911,275 $2.34 1 $2,132,384 Large (Scen. 1)1,089,000 $1.25 $1,361,250 $3,493,634 2,000,275 45.92 ac Scenario Two Overall (Scen. 2)3,954,377 $1.00 $3,954,377 $3,954,377 90.78 ac 1.From September, 2023 CBRE airport analysis, incorporated by reference Compiled by CBRE According to the above table it appears that the highest and best use would be reflected by Scenario Two. Several issues for consideration are also noted as follows: -The above figures reflect land values. No improvement value is ascribed. -For the Scenario One, Small site analysis, the conclusions may be further influenced by a lengthy absorption period, which is not reflected in the above conclusion. -Under Scenario Two, no provision is made for the removal of improvements. This analysis assumes that prior to disposition, the City would remove all tenants. COML Council Packet 11-14-23, Page 91 of 277 Highest and Best Use 30 CB23US061656-2© 2023 CBRE, Inc. -Also under Scenario Two, no provision is made for the cost of potentially removing the existing runway, if desired or for dealing with potential FAA issues, if any. As shown above there are numerous factors that may influence each conclusion, depending upon specific requirements applied, decisions made or unforeseen circumstances. For analysis purposes however, the conclusion of Highest and Best Use is concluded to be future Light Industrial use. AS IMPROVED The analysis reflects land value only under two Scenarios. No improvements are considered. COML Council Packet 11-14-23, Page 92 of 277 Valuation 31 CB23US061656-2© 2023 CBRE, Inc. Valuation Methodology This methodology analyzes land sales in the subject’s market area applying adjustments for specific characteristics that differ from the subject. Based on our Highest and Best Use conclusion the property is assumed to be available for near term rezone to Light Industrial. With this in mind, industrially-zoned land is considered most comparable in terms of property characteristics, intensity of use and allowed uses. The following map and table summarize the comparable data used in the valuation of the subject site. A detailed description of each transaction is included in the addenda. COML Council Packet 11-14-23, Page 93 of 277 Valuation 32 CB23US061656-2© 2023 CBRE, Inc. Analysis Size Size Price No.Property Location Date Price (Acres) (SF) Per SF Zoning Utilities 1 Quincy Industrial Land Road 11 NW Quincy, WA 98848 Aug-21 $3,500,000 75.90 3,306,204 $1.06 U.Ind.Water/sewer 2 Road 40 E 71.87-Acre Industrial Parcel NKA (Road 40 E) Pasco, WA 99301 Mar-22 $5,200,000 71.87 3,130,657 $1.66 LI Water/sewer 3 West Spokane Interstate 90 Land 11515 W Medical Lake Road Spokane, WA 99004 Jul-20 $6,000,000 92.77 4,041,061 $1.48 IL Water/sewer - req. ext. 4 Future Amazon Center W. Side Road 40 E Pasco, WA 99301 Sep-21 $6,786,000 104.40 4,547,664 $1.49 I-2 All Avail. 5 3003 Kingsgate Way Richland, WA 99354 Mar-19 $1,720,714 39.16 1,705,810 $1.01 M2 All Avail. 6 Future Barker Storage 4303 N. Barker Rd Spokane Valley, WA 99027 Feb-21 $1,100,000 23.46 1,021,918 $1.08 Ind.All Avail. 7 14000 W. McFarlane Road Spokane, WA 99022 Listing $1,500,000 66.47 2,895,433 $0.52 LI Water Uncertain Additional Data Considered 8 2405 NE Road L Moses Lake, WA 98837 Dec-18 $1,400,000 78.37 3,413,797 $0.41 UC/UR Water 9 Future Commercial/Ind.Park 12115 Wheeler Rd. NE Moses Lake, WA Sale fail $2,564,769 60.70 2,644,092 $0.97 UR-Ind Planned All Avail. Subject 3540 Municipal Airport Rd NE Moses Lake, WA 98837 ------90.78 3,954,377 ---Assumed LI ReZone Water/sewer Compiled by CBRE SUMMARY OF COMPARABLE LAND SALES Transaction DISCUSSION OF SALES AND RELEVANT ADJUSTMENTS The sales utilized represent the best data available for comparison with the subject and were selected from the surrounding market area, reflecting the size and zoning of the subject. Details of each transaction are included in the addenda to this report. DISCUSSION OF SIGNIFICANT ADJUSTMENTS We have provided an adjustment chart identifying appropriate adjustments for the comparable sales relative to the subject sites. These adjustments, when necessary, adjustments were made for differences in various elements of comparison, including property rights conveyed, financing terms, conditions of sale, expenditures made immediately after purchase, market conditions, location, and other physical characteristics. If the element in comparison is considered superior to that of the subject, we applied a negative adjustment. Conversely, a positive adjustment to the comparable was applied if inferior. A summary of the elements of comparison follows. Transactional/Financial Adjustments Transaction adjustments include: (1) real property rights conveyed, (2) financing terms, (3) conditions of sale, and (4) expenditures made immediately after purchase. These items, which are applied prior to the application of the market conditions and property adjustments, are discussed as follows. COML Council Packet 11-14-23, Page 94 of 277 Valuation 33 CB23US061656-2© 2023 CBRE, Inc. The first category of adjustments includes rights conveyed, market conditions (time), financing, and issues relating to the interests purchased. The subsequent category of adjustments reflects the physical features and locational differences. Rights Conveyed relates to the actual interests transferred. This category can include adjustments for entitlements included in the sale, among other things. Conditions of Sale reflect adjustments for sales, which occurred under unusual and specific conditions. This category is different than the adjustment for time, which will be dealt with subsequently. No adjustments were warranted. Financing adjustments are necessary for sales that were financed with atypical terms. This includes seller financing with non-market interest rates or atypical down payment levels; the theory being that a comparable figure for use in appraisal analysis should reflect a cash-equivalent price, or a price that is in line with existing market terms at the time of sale. All of the comparable sales had typical of all cash financing, there for no adjustments were necessary. In terms of adjustment support for time (market conditions), we have reviewed the market industrial property in the surrounding area and have found that paired sales activity is extremely limited. Discussions with brokers, as well as our observations of market activity lead us to conclude that the pricing for similar properties to the subject has increased very modestly over the past several years. No Market conditions adjustment is applied to most of the sales however Sale 7, which is currently a listing, has been adjusted downward to reflect its lack of close status. Also- considered-Sale number 8 was under contract in 2020 but failed to close. Property Adjustments Property adjustments will be expressed qualitatively for differences reflected by the various characteristics of the property. These adjustments are based on locational and physical characteristics and are applied after the application of transaction and market conditions adjustments, above. Physical characteristics, including differences in the location, size, site quality, access, and zoning or land use issues, are now discussed and associated adjustments are generally discussed in the chart as follows: Location: Location adjustments can be somewhat subjective and have been made, when appropriate, to address differences in overall appeal, proximity to core services, and other amenities. Most sales are drawn from larger cities and downward adjustments are applied. Size: Adjustments are applied to each comparable, as appropriate, to address differences in parcel size (usable square feet), as compared to the subject property. Because these adjustments are made to unit price, and due to economies of scale, properties which are smaller than the subject receive a COML Council Packet 11-14-23, Page 95 of 277 Valuation 34 CB23US061656-2© 2023 CBRE, Inc. downward unit price adjustment, and conversely, significantly larger properties receive an upward unit price adjustment. Site Quality: Site quality adjustments are also somewhat subjective and can include, but are not limited to variations in topography, shape, critical areas and easements (if not discussed separately) and overall appeal. Note that critical areas such as wetlands have been addressed by excluding such areas from usable land calculations. In general, most sales are of generally full utility though we have applied an upward adjustment to Sale 7 as being inferior. Utilities Adjustments have been applied to Sales 3 and 7 for generally inferior utilities relative to the subject property. The remaining sales appear to have generally similar access to public utilities. Infras./Access: Adjustments in this category may address superior or inferior characteristics such as proximity to signalized intersections, or limitations to access. The majority of Sales have public road access though Sale 7 is considered inferior in this regard and an adjustment is applied. Zoning/Land Use: While most of the comparable sales used in our analysis are zoned for industrial use, certain jurisdictions and zoning classifications allow for more commercial use such as retail or hotel/motel uses. Adjustments may be made here to address significant differences in the zoning, which appear to be nominal. The subject, while currently zoned for Aviation, is assumed to be rezoned within 6 months (see extraordinary assumption) for alternative use in this analysis. As such, no adjustments are considered necessary. Conclusion of Land Value The subject site is flat, fully usable Industrial parcel of land measuring roughly 90 acres. Below is a summary of adjustments applied to the comparable sales above relative to the characteristics of our subject sites: LAND SALES ADJUSTMENT CHART Transactional Adjustments Physical AdjustmentsPrice/Rights Condit.Market Interim Site Zoning CumulativeComp sf.Conveyed of Sale Financ.Cond. Indication Location Size Quality Utilities Access Land Use Indication 1 $1.06 0 0 0 0 $1.06 Similar Similar Similar Similar Similar Similar Similar 2 $1.66 0 0 0 0 $1.66 Sup(-)Similar Similar Similar Similar Similar Superior 3 $1.48 0 0 0 0 $1.48 Sup(--)Similar Similar Inf(+)Similar Similar Superior4$1.49 0 0 0 0 $1.49 Sup(-)Similar Similar Similar Similar Similar Superior5$1.01 0 0 0 Inf(+)$1.01 Sup(-) Sup(-)Similar Similar Similar Similar Superior 6 $1.08 0 0 0 0 $1.08 Sup(-) Sup(-)Similar Similar Similar Similar Superior 7 $0.52 0 Sup(-)0 0 $0.52 Sup(-)Similar Inf(+) Inf(+) Inf(+)Similar Inferior After adjustment, the Sales indicate a value well above $0.52/sf and at or below $1.00/sf. Sale 5 suggests a value below $1.00/sf however appears to be somewhat of an outlier, as Sale 1 renders an overall Similar indication at $1.06/sf. Sales 2 and 3 are clearly superior indicators in the $1.45-$1.66/sf range. Given the size and characteristics of the subject property and considering the above analysis, a value of $1.00 per square foot is considered reasonable for the subject property. Additional commentary from local market participants is summarized as follows: COML Council Packet 11-14-23, Page 96 of 277 Valuation 35 CB23US061656-2© 2023 CBRE, Inc. MARKET PARTICIPANTS Broker Name/Company Range Comments Rick Crittenden None given Landowner: Broker Railroad project has impacted some land sales along Wheeler Road due to the uncertainty of where it may run. Andrew w/ Lybbert RE None given PUD pricing for electricity has impacted some potential industrial development of data centers, limiting land value in conjunction with projected utility expenses. Land Value Conclusion The concluded land value for the subject is summarized as follows: SUMMARY OF CONCLUSION Appraisal Premise As of Date Value Conclusion Fee Simple August 14, 2023 3,950,000 (Light Ind. Potential) Compiled by CBRE As shown, the property value under the assumption of conversion to Light Industrial exceeds the utility as airport use primarily due to the required land area necessary for airport infrastructure. We note that this analysis assumes that conversion to Light Industrial zoning would be relatively simple to accomplish (based in part on conversations with local planning personnel). Also of note is the lack of improvement value reflected in the conclusion above. The current improvement value is generally driven by the current aviation use, and it is uncertain whether individual buyers may find value in these improvements. Conversely, there is no deduction applied for the potential need for a buyer to demolish improvements that may not be necessary. This is considered a factor that will be considered by the City in the event the property however without definitive guidance on this not deduction is reflected here. COML Council Packet 11-14-23, Page 97 of 277 Assumptions and Limiting Conditions 36 CB23US061656-2© 2023 CBRE, Inc. Assumptions and Limiting Conditions 1.CBRE, Inc. through its appraiser (collectively, “CBRE”) has inspected through reasonable observation the subject property. However, it is not possible or reasonably practicable to personally inspect conditions beneath the soil and the entire interior and exterior of the improvements on the subject property. Therefore, no representation is made as to such matters. 2.The report, including its conclusions and any portion of such report (the “Report”), is as of the date set forth in the letter of transmittal and based upon the information, market, economic, and property conditions and projected levels of operation existing as of such date. The dollar amount of any conclusion as to value in the Report is based upon the purchasing power of the U.S. Dollar on such date. The Report is subject to change as a result of fluctuations in any of the foregoing. CBRE has no obligation to revise the Report to reflect any such fluctuations or other events or conditions which occur subsequent to such date. 3.Unless otherwise expressly noted in the Report, CBRE has assumed that: (i)Title to the subject property is clear and marketable and that there are no recorded or unrecorded matters or exceptions to title that would adversely affect marketability or value. CBRE has not examined title records (including without limitation liens, encumbrances, easements, deed restrictions, and other conditions that may affect the title or use of the subject property) and makes no representations regarding title or its limitations on the use of the subject property. Insurance against financial loss that may arise out of defects in title should be sought from a qualified title insurance company. (ii)Existing improvements on the subject property conform to applicable local, state, and federal building codes and ordinances, are structurally sound and seismically safe, and have been built and repaired in a workmanlike manner according to standard practices; all building systems (mechanical/electrical, HVAC, elevator, plumbing, etc.) are in good working order with no major deferred maintenance or repair required; and the roof and exterior are in good condition and free from intrusion by the elements. CBRE has not retained independent structural, mechanical, electrical, or civil engineers in connection with this appraisal and, therefore, makes no representations relative to the condition of improvements. CBRE appraisers are not engineers and are not qualified to judge matters of an engineering nature, and furthermore structural problems or building system problems may not be visible. It is expressly assumed that any purchaser would, as a precondition to closing a sale, obtain a satisfactory engineering report relative to the structural integrity of the property and the integrity of building systems. (iii)Any proposed improvements, on or off-site, as well as any alterations or repairs considered will be completed in a workmanlike manner according to standard practices. (iv)Hazardous materials are not present on the subject property. CBRE is not qualified to detect such substances. The presence of substances such as asbestos, urea formaldehyde foam insulation, contaminated groundwater, mold, or other potentially hazardous materials may affect the value of the property. (v)No mineral deposit or subsurface rights of value exist with respect to the subject property, whether gas, liquid, or solid, and no air or development rights of value may be transferred. CBRE has not considered any rights associated with extraction or exploration of any resources, unless otherwise expressly noted in the Report. (vi)There are no contemplated public initiatives, governmental development controls, rent controls, or changes in the present zoning ordinances or regulations governing use, density, or shape that would significantly affect the value of the subject property. (vii)All required licenses, certificates of occupancy, consents, or other legislative or administrative authority from any local, state, nor national government or private entity or organization have been or can be readily obtained or renewed for any use on which the Report is based. (viii)The subject property is managed and operated in a prudent and competent manner, neither inefficiently or super-efficiently. (ix)The subject property and its use, management, and operation are in full compliance with all applicable federal, state, and local regulations, laws, and restrictions, including without limitation environmental laws, seismic hazards, flight patterns, decibel levels/noise envelopes, fire hazards, hillside ordinances, density, allowable uses, building codes, permits, and licenses. (x)The subject property is in full compliance with the Americans with Disabilities Act (ADA). CBRE is not qualified to assess the subject property’s compliance with the ADA, notwithstanding any discussion of possible readily achievable barrier removal construction items in the Report. COML Council Packet 11-14-23, Page 98 of 277 Assumptions and Limiting Conditions 37 CB23US061656-2© 2023 CBRE, Inc. (xi)All information regarding the areas and dimensions of the subject property furnished to CBRE are correct, and no encroachments exist. CBRE has neither undertaken any survey of the boundaries of the subject property nor reviewed or confirmed the accuracy of any legal description of the subject property. Unless otherwise expressly noted in the Report, no issues regarding the foregoing were brought to CBRE’s attention, and CBRE has no knowledge of any such facts affecting the subject property. If any information inconsistent with any of the foregoing assumptions is discovered, such information could have a substantial negative impact on the Report. Accordingly, if any such information is subsequently made known to CBRE, CBRE reserves the right to amend the Report, which may include the conclusions of the Report. CBRE assumes no responsibility for any conditions regarding the foregoing, or for any expertise or knowledge required to discover them. Any user of the Report is urged to retain an expert in the applicable field(s) for information regarding such conditions. 4.CBRE has assumed that all documents, data and information furnished by or behalf of the client, property owner, or owner’s representative are accurate and correct, unless otherwise expressly noted in the Report. Such data and information include, without limitation, numerical street addresses, lot and block numbers, Assessor’s Parcel Numbers, land dimensions, square footage area of the land, dimensions of the improvements, gross building areas, net rentable areas, usable areas, unit count, room count, rent schedules, income data, historical operating expenses, budgets, and related data. Any error in any of the above could have a substantial impact on the Report. Accordingly, if any such errors are subsequently made known to CBRE, CBRE reserves the right to amend the Report, which may include the conclusions of the Report. The client and intended user should carefully review all assumptions, data, relevant calculations, and conclusions of the Report and should immediately notify CBRE of any questions or errors within 30 days after the date of delivery of the Report. 5.CBRE assumes no responsibility (including any obligation to procure the same) for any documents, data or information not provided to CBRE, including without limitation any termite inspection, survey or occupancy permit. 6.All furnishings, equipment and business operations have been disregarded with only real property being considered in the Report, except as otherwise expressly stated and typically considered part of real property. 7.Any cash flows included in the analysis are forecasts of estimated future operating characteristics based upon the information and assumptions contained within the Report. Any projections of income, expenses and economic conditions utilized in the Report, including such cash flows, should be considered as only estimates of the expectations of future income and expenses as of the date of the Report and not predictions of the future. Actual results are affected by a number of factors outside the control of CBRE, including without limitation fluctuating economic, market, and property conditions. Actual results may ultimately differ from these projections, and CBRE does not warrant any such projections. 8.The Report contains professional opinions and is expressly not intended to serve as any warranty, assurance or guarantee of any particular value of the subject property. Other appraisers may reach different conclusions as to the value of the subject property. Furthermore, market value is highly related to exposure time, promotion effort, terms, motivation, and conclusions surrounding the offering of the subject property. The Report is for the solepurpose of providing the intended user with CBRE’s independent professional opinion of the value of the subject property as of the date of the Report. Accordingly, CBRE shall not be liable for any losses that arise from any investment or lending decisions based upon the Report that the client, intended user, or any buyer, seller, investor, or lending institution may undertake related to the subject property, and CBRE has not been compensated to assume any of these risks. Nothing contained in the Report shall be construed as any direct or indirect recommendation of CBRE to buy, sell, hold, or finance the subject property. 9.No opinion is expressed on matters which may require legal expertise or specialized investigation or knowledge beyond that customarily employed by real estate appraisers. Any user of the Report is advised to retain experts in areas that fall outside the scope of the real estate appraisal profession for such matters. 10.CBRE assumes no responsibility for any costs or consequences arising due to the need, or the lack of need, for flood hazard insurance. An agent for the Federal Flood Insurance Program should be contacted to determine the actual need for Flood Hazard Insurance. 11.Acceptance or use of the Report constitutes full acceptance of these Assumptions and Limiting Conditions and any special assumptions set forth in the Report. It is the responsibility of the user of the Report to read in full, comprehend and thus become aware of all such assumptions and limiting conditions. CBRE assumes no responsibility for any situation arising out of the user’s failure to become familiar with and understand the same. 12.The Report applies to the property as a whole only, and any pro ration or division of the title into fractional interests will invalidate such conclusions, unless the Report expressly assumes such pro ration or division of interests. COML Council Packet 11-14-23, Page 99 of 277 Assumptions and Limiting Conditions 38 CB23US061656-2© 2023 CBRE, Inc. 13.The allocations of the total value estimate in the Report between land and improvements apply only to the existing use of the subject property. The allocations of values for each of the land and improvements are not intended to be used with any other property or appraisal and are not valid for any such use. 14.The maps, plats, sketches, graphs, photographs, and exhibits included in this Report are for illustration purposes only and shall be utilized only to assist in visualizing matters discussed in the Report. No such items shall be removed, reproduced, or used apart from the Report. 15.The Report shall not be duplicated or provided to any unintended users in whole or in part without the written consent of CBRE, which consent CBRE may withhold in its sole discretion. Exempt from this restriction is duplication for the internal use of the intended user and its attorneys, accountants, or advisors for the sole benefit of the intended user. Also exempt from this restriction is transmission of the Report pursuant to any requirement of any court, governmental authority, or regulatory agency having jurisdiction over the intended user, provided that the Report and its contents shall not be published, in whole or in part, in any public document without the written consent of CBRE, which consent CBRE may withhold in its sole discretion. Finally, the Report shall not be made available to the public or otherwise used in any offering of the property or any security, as defined by applicable law. Any unintended user who may possess the Report is advised that it shall not rely upon the Report or its conclusions and that it should rely on its own appraisers, advisors and other consultants for any decision in connection with the subject property. CBRE shall have no liability or responsibility to any such unintended user. COML Council Packet 11-14-23, Page 100 of 277 Addenda © 2023 CBRE, Inc. ADDENDA COML Council Packet 11-14-23, Page 101 of 277 Addenda © 2023 CBRE, Inc. Addendum A INDUSTRIAL LAND SALE DATA SHEETS COML Council Packet 11-14-23, Page 102 of 277 Sale Land - Industrial No. 1 Property Name Quincy Industrial Land Address Road 11 NW Quincy, WA 98848 United States Government Tax Agency Grant Govt./Tax ID 200792000 Site/Government Regulations Acres Square feet Land Area Net 75.900 3,306,204 Land Area Gross 75.900 3,306,204 Site Development Status Raw Shape Irregular Topography Generally Level Utilities All Available Maximum FAR N/A Min Land to Bldg Ratio N/A Maximum Density N/A Frontage Distance/Street N/A Road 11 NW General Plan N/A Specific Plan N/A Zoning Industrial & Agriculture Entitlement Status N/A Sale Summary Recorded Buyer TG Downs LLC Marketing Time 47 Month(s) True Buyer TG Downs LLC Buyer Type N/A Recorded Seller Jon R Patton Etal & Roger W & Ann Diem Patton Etal Seller Type Private Investor True Seller Jon R Patton Etal & Roger W & Ann Diem Patton Etal Primary Verification Tom Parrish Windermere 509-787- 4536 Interest Transferred N/A Type Sale Current Use Agriculture Date 8/13/2021 Proposed Use Unknown Sale Price $3,500,000 Listing Broker Tom Parrish Financing Market Rate Financing Selling Broker N/A Cash Equivalent $3,500,000 Doc #1456083 Capital Adjustment $0 Adjusted Price $3,500,000 Transaction Summary plus Five-Year CBRE View History Transaction Date Transaction Type Buyer Seller Price Price/ac and /sf 08/2021 Sale TG Downs LLC Jon R Patton Etal & Roger W & Ann Diem Patton Etal $3,500,000 $46,113 / $1.06 01/2019 Under Contract N/A N/A $3,000,000 $39,526 / $0.91 COML Council Packet 11-14-23, Page 103 of 277 Sale Land - Industrial No. 1 Units of Comparison $1.06 / sf N/A / Unit $46,113.31 / ac N/A / Allowable Bldg. Units N/A / Building Area Financial No information recorded Map & Comments This comparable represents the current listing of 75.9 acres of land in Quincy, Washington. The land is situated within a quarter mile of Sabey and Vantage data facilities and has fiber optics, water, sewer and electricity all available to the site, making it optimal for use as a data center site. The site is located within the Quincy Urban Growth Area and is currently zoned Agriculture; however, industrial uses are permitted. According to the listing broker, this site might have been underpriced, given pending land sales to Microsoft of over $50,000 per acre, though maintained the lower price, as this property is somewhat further from town than other recent land sales and needs to be rezoned although right next to the industrial zone. The site sold in August 2021 for 3,500,000 or $1.06 per square foot. COML Council Packet 11-14-23, Page 104 of 277 Sale Land - Industrial No. 2 Property Name Road 40 E 71.87-Acre Industrial Parcel Address NKA (Road 40 E) Pasco, WA 99301 United States Government Tax Agency Franklin Govt./Tax ID 112540082 Site/Government Regulations Acres Square feet Land Area Net 71.870 3,130,657 Land Area Gross 71.870 3,130,657 Site Development Status Raw Shape Other(See Comments) Topography Generally Level Utilities All available to the site Maximum FAR N/A Min Land to Bldg Ratio N/A Maximum Density N/A General Plan N/A Specific Plan N/A Zoning I-1, Light Industrial Entitlement Status N/A Sale Summary Recorded Buyer Pasco Road 40 LLC Marketing Time 2 Month(s) True Buyer Pasco Road 40 LLC Buyer Type Developer Recorded Seller Jay D Compton Seller Type Private Investor True Seller Jay D Compton Primary Verification Buyer & Listing Agent/Rob Ellsworth of SVN Interest Transferred Fee Simple/Freehold Type Sale Current Use N/A Date 3/15/2022 Proposed Use N/A Sale Price $5,200,000 Listing Broker N/A Financing Market Rate Financing Selling Broker N/A Cash Equivalent $5,200,000 Doc #SWD-1957936 Capital Adjustment $0 Adjusted Price $5,200,000 Transaction Summary plus Five-Year CBRE View History Transaction Date Transaction Type Buyer Seller Price Price/ac and /sf 03/2022 Sale Pasco Road 40 LLC Jay D Compton $5,200,000 $72,353 / $1.66 COML Council Packet 11-14-23, Page 105 of 277 Sale Land - Industrial No. 2 Units of Comparison $1.66 / sf N/A / Unit $72,352.86 / ac N/A / Allowable Bldg. Units N/A / Building Area Financial No information recorded Map & Comments This is the March 2022 sale 71.87-acre industrial parcel along the west side of S Road 40 E in Pasco, Washington. The property was listed for sale in mid-January 2022 for $5,000,000 under the premise the seller would review offers beginning March 3, 2022. Additionally, the seller was able to accept any offer prior to March 3, 2022. Three cash offers were received within two days and two were above the asking price. The seller accepted an offer by Tarragon LLC for $5,500,000, or $1.76/SF. During due diligence the price was reduced to $5,200,000. The sale closed on March 15, 2022 for $5,200,000, or $1.66/SF. The buyer has plans to construct an industrial park on the site. COML Council Packet 11-14-23, Page 106 of 277 Sale Land - Industrial No. 3 Property Name West Spokane Interstate 90 Land Address 11515 W Medical Lake Road Spokane, WA 99004 United States Government Tax Agency Spokane Govt./Tax ID 14121.9027 Site/Government Regulations Acres Square feet Land Area Net 92.770 4,041,061 Land Area Gross 92.770 4,041,061 Site Development Status Raw Shape Irregular Topography Generally Level Utilities N/A Maximum FAR N/A Min Land to Bldg Ratio N/A Maximum Density N/A General Plan N/A Specific Plan N/A Zoning IL, Industrial Light Entitlement Status N/A Sale Summary Recorded Buyer MMC Investments, LLC Marketing Time 19 Month(s) True Buyer N/A Buyer Type Developer Recorded Seller N/A Seller Type Private Investor True Seller N/A Primary Verification John Hillier of SVN 509-939-8094 Interest Transferred Fee Simple/Freehold Type Sale Current Use N/A Date 7/28/2020 Proposed Use N/A Sale Price $6,000,000 Listing Broker John Hillier of SVN Financing Market Rate Financing Selling Broker N/A Cash Equivalent $6,000,000 Doc #202010309 Capital Adjustment $0 Adjusted Price $6,000,000 Transaction Summary plus Five-Year CBRE View History Transaction Date Transaction Type Buyer Seller Price Price/ac and /sf 07/2020 Sale MMC Investments, LLC N/A $6,000,000 $64,676 / $1.48 COML Council Packet 11-14-23, Page 107 of 277 Sale Land - Industrial No. 3 Units of Comparison $1.48 / sf N/A / Unit $64,676.08 / ac N/A / Allowable Bldg. Units N/A / Building Area Financial No information recorded Map & Comments This is the July 2020 sale of the 92.77 acres of light industrial land at 11515 W Medical Lake Road in Spokane, Washington. The property sold for $6,000,000, or $1.48 after being listed for at the most recent list price of $2.00/SF. The property is just north of Interstate 90 and west of an Interstate 90 overpass. The buyer has plans to develop an industrial business park on the site. Notably, there is a large Amazon Distribution Center located east of this site. Utilities are east of the site and will need to be brough to the site. COML Council Packet 11-14-23, Page 108 of 277 Sale Land - Industrial No. 4 Property Name Future Amazon Distribution Center (Project Pearl) Address NKA (W Side of Road 40 E) Pasco, WA 99301 United States Government Tax Agency Franklin Govt./Tax ID 112530053 Site/Government Regulations Acres Square feet Land Area Net 104.400 4,547,664 Land Area Gross 104.400 4,547,664 Site Development Status Raw Shape Rectangular Topography Generally Level Utilities All Available Maximum FAR N/A Min Land to Bldg Ratio N/A Maximum Density N/A General Plan N/A Specific Plan N/A Zoning I-2, Medium Industrial Entitlement Status N/A Sale Summary Recorded Buyer Project Pearl Pasco LLC Marketing Time N/A True Buyer N/A Buyer Type Developer Recorded Seller Columbia East LLC Seller Type Private Investor True Seller N/A Primary Verification Charles Laird of Tippett Company Interest Transferred Fee Simple/Freehold Type Sale Current Use N/A Date 9/2/2021 Proposed Use N/A Sale Price $6,786,000 Listing Broker N/A Financing Market Rate Financing Selling Broker N/A Cash Equivalent $6,786,000 Doc #SWD-1946612 Excise #69501 Capital Adjustment $0 Adjusted Price $6,786,000 Transaction Summary plus Five-Year CBRE View History Transaction Date Transaction Type Buyer Seller Price Price/ac and /sf 09/2021 Sale Project Pearl Pasco LLC Columbia East LLC $6,786,000 $65,000 / $1.49 COML Council Packet 11-14-23, Page 109 of 277 Sale Land - Industrial No. 4 Units of Comparison $1.49 / sf N/A / Unit $65,000.00 / ac N/A / Allowable Bldg. Units N/A / Building Area Financial No information recorded Map & Comments This is the September 2021 sale of the 104.40-acre site along the west side of S Road 40 E and south of A Street in Pasco, Washington. The site was purchased for the development of an Amazon Distribution Center for $6,786,000, or $1.49/SF. The property had been available for sale for several years prior to this transaction. Amazon had recently acquired the site to the east for the construction of a distribution center. COML Council Packet 11-14-23, Page 110 of 277 Sale Land - Industrial No. 5 Property Name Richland Industrial Land Address 3003 Kingsgate Way Richland, WA 99354 United States Government Tax Agency Benton Govt./Tax ID 121082013597004 Site/Government Regulations Acres Square feet Land Area Net 39.160 1,705,810 Land Area Gross 39.160 1,705,810 Site Development Status Raw Shape Irregular Topography Rolling Utilities In the street Maximum FAR N/A Min Land to Bldg Ratio N/A Maximum Density N/A Frontage Distance/Street N/A Kingsgate Way General Plan Horn Rapids Industrial Park Specific Plan Industrial Zoning M-2, Heavy Manufacturing Entitlement Status N/A Sale Summary Recorded Buyer Packing Corporation of America Marketing Time 52 Month(s) True Buyer Packing Corporation of America Buyer Type Corporation Recorded Seller City of Richland Seller Type Public Syndicator True Seller City of Richland Primary Verification Darrin Arrasmith (City of Richland) Interest Transferred Fee Simple/Freehold Type Sale Current Use Vacant Land Date 3/27/2019 Proposed Use Industrial Sale Price $1,720,714 Listing Broker N/A Financing Not Available Selling Broker N/A Cash Equivalent $1,720,714 Doc #2019007387 Capital Adjustment $0 Adjusted Price $1,720,714 Transaction Summary plus Five-Year CBRE View History Transaction Date Transaction Type Buyer Seller Price Price/ac and /sf 03/2019 Sale Packing Corporation of America City of Richland $1,720,714 $43,941 / $1.01 COML Council Packet 11-14-23, Page 111 of 277 Sale Land - Industrial No. 5 Units of Comparison $1.01 / sf N/A / Unit $43,940.60 / ac N/A / Allowable Bldg. Units N/A / Building Area Financial No information recorded Map & Comments This is the sale of a 39.16 acre (1,705,809 square foot) site located at 3003 Kingsgate Way in the Horn Rapids Industrial Park in Richland, Washington. The size is zoned M-2 (Heavy Manufacturing) and has all utilities available in the street. The site is cleared but is gently rolling. It would require some leveling, which is common in this area. This site is well located with good frontage on Kingsgate Way and direct access to Highway 240. The site had been listed on the market since February 2013 and the seller was the City of Richland and the buyer was Packing Corporation of America, a nation corporation. No further information regarding the sale or potential development were available. The property sold in March 2019 for $1,720,714 or $1.01 per square foot ($43,940.60 per acre). We note that after the sale, there was a boundary line adjustment recorded in June 2019. The parcel number changed from 121082000001001 to 121082013597004. COML Council Packet 11-14-23, Page 112 of 277 Sale Land - Industrial No. 6 Property Name Future Barker Storage Address 4303 N. Barker Road Spokane Valley, WA 99027 United States Government Tax Agency N/A Govt./Tax ID 55061.9062 & 55061.9063 Site/Government Regulations Acres Square feet Land Area Net 23.460 1,021,918 Land Area Gross 23.460 1,021,918 Site Development Status Other(See Comments) Shape Irregular Topography Varies Utilities All available; sewer recently installed nearby Maximum FAR N/A Min Land to Bldg Ratio N/A Maximum Density N/A Frontage Distance/Street 330 ft Barker Road General Plan N/A Specific Plan N/A Zoning I Industrial Entitlement Status N/A Property Name Future Barker Storage Address 4303 N. Barker Road Spokane Valley, WA 99027 United States Government Tax Agency N/A Govt./Tax ID 55061.9062 & 55061.9063 Site/Government Regulations Acres Square feet Land Area Net 23.460 1,021,918 Land Area Gross 23.460 1,021,918 Site Development Status Other(See Comments) Shape Irregular Topography Varies Utilities All available; sewer recently installed nearby Maximum FAR N/A Min Land to Bldg Ratio N/A Maximum Density N/A Frontage Distance/Street 330 ft Barker Road General Plan N/A Specific Plan N/A Zoning I Industrial Entitlement Status N/A COML Council Packet 11-14-23, Page 113 of 277 Acres Square feet Land Area Net 23.460 1,021,918 Land Area Gross 23.460 1,021,918 Site Development Status Other(See Comments) Shape Irregular Topography Varies Utilities All available; sewer recently installed nearby Maximum FAR N/A Min Land to Bldg Ratio N/A Maximum Density N/A Frontage Distance/Street 330 ft Barker Road General Plan N/A Specific Plan N/A Zoning I Industrial Entitlement Status N/A Sale Summary Recorded Buyer Barker Storage, LLC Marketing Time 30 Month(s) True Buyer same Buyer Type End User Recorded Seller Thomas Dean Shelly Seller Type Private Investor True Seller same Primary Verification Jason Sorge, Property Manager, 509- 951-7933 Interest Transferred Fee Simple/Freehold Type Sale Current Use See comments Date 2/27/2021 Proposed Use Self-Storage Sale Price $1,100,000 Listing Broker N/A Financing N/A Selling Broker N/A Cash Equivalent $1,100,000 Doc #6810262 Capital Adjustment $0 Adjusted Price $1,100,000 Transaction Summary plus Five-Year CBRE View History Transaction Date Transaction Type Buyer Seller Price Price/ac and /sf 02/2021 Sale Barker Storage, LLC Thomas Dean Shelly $1,100,000 $46,888 / $1.08 COML Council Packet 11-14-23, Page 114 of 277 Sale Land - Industrial No. 6 Units of Comparison $1.08 / sf N/A / Unit $46,888.32 / ac N/A / Allowable Bldg. Units N/A / Building Area Financial No information recorded Map & Comments The site is located on a well-known arterial, Barker Road, and has visibility from Trent Avenue although no access from this roadway. The neighborhood has been developing with the addition of Katerra and the construction of industrial buildings to the south. The site is irregularly-shaped but is still suitable for development. Sewer was recently added and public water is available. The existing buildings include a 720-sf farm house, 2,848-sf home, and two shops (2,640 sf and 2,160 sf). The property was listed in August 2017 for $1.4 million and again in October 2018 for $1.2 million. The buyers placed no value on the improvements. They feel they got a good deal. They will construct a self-storage facility on the majority of the site and will leave the eastern portion vacant for future development (possible car wash). It closed for $1,100,000 or $1.08 per square foot of land. COML Council Packet 11-14-23, Page 115 of 277 Available/Listing Land - Industrial No. 7 Property Name 14000 Block W McFarlane Road Site Address NKA (14000 Block W McFarlane Road) Spokane, WA 99022 United States Government Tax Agency Spokane Govt./Tax ID Multiple Site/Government Regulations Acres Square feet Land Area Net 66.470 2,895,433 Land Area Gross 66.470 2,895,433 Site Development Status Raw Shape Irregular Topography Generally Level Utilities N/A Maximum FAR N/A Min Land to Bldg Ratio N/A Maximum Density N/A General Plan N/A Specific Plan N/A Zoning LI, Light Industrial Entitlement Status N/A Sale Summary Recorded Buyer N/A Marketing Time 31 Month(s) True Buyer N/A Buyer Type N/A Recorded Seller Crawford Holdings LLC Seller Type Private Investor True Seller N/A Primary Verification Listing Agent Interest Transferred Fee Simple/Freehold Type Available/Listing Current Use N/A Date 6/21/2023 Proposed Use N/A Sale Price $1,500,000 Listing Broker Mark and Tracy Lucas of Kiemle Hagood Financing Cash to Seller Selling Broker N/A Cash Equivalent $1,500,000 Doc #Listing Capital Adjustment $0 Adjusted Price $1,500,000 Transaction Summary plus Five-Year CBRE View History Transaction Date Transaction Type Buyer Seller Price Price/ac and /sf 06/2023 Available/Listing N/A Crawford Holdings LLC $1,500,000 $22,567 / $0.52 COML Council Packet 11-14-23, Page 116 of 277 Available/Listing Land - Industrial No. 7 Units of Comparison $0.52 / sf N/A / Unit $22,566.57 / ac N/A / Allowable Bldg. Units N/A / Building Area Financial No information recorded Map & Comments This is the current (March) listing of the 66.47-acre site located on the 1400 block of W McFarlane Road in unincorporated Spokane County. The site is zoned light industrial and is approximately two blocks south of Highway 2, east of Rambo Road, and west of Craig Road. The property has been on the market for over two years for $1,500,000, or $0.52/SF. The listing agent confirmed there has been little to no interest in the property at the current listing price, suggesting the listing price is above market. Sewer is available in Craig Road and water service main is just south of the southeast corner of McFarlane Road and Craig Road. Per the listing broker the buyer would have to petition the City of Spokane for water service. COML Council Packet 11-14-23, Page 117 of 277 Addenda © 2023 CBRE, Inc. Addendum B APPRAISER QUALIFICATIONS COML Council Packet 11-14-23, Page 118 of 277 1 ©2021 CBRE, INC. PROFILE S.Murray Brackett, MAI Director of Right of Way, Aviation and Public Projects, Northwest Region T +1 206 292 1600 M +1 206 595 1068 E murray.brackett@cbre.com WA. Lic. 1100853 Professional Experience Mr. Brackett has been Appraising Real Property since 1985 and is currently a Director with CBRE in the Valuation Advisory Services division. He was formerly a partner with ABS Valuation for over 20 years. Professional responsibilities include the full range of commercial, industrial, residential product, including complex land valuations up to 100,000 acres in size. A considerable portion of his work involves partial acquisitions relating to eminent domain and conservation easements. In addition, a wide variety of Aviation related appraisals have been completed, including Ground lease revaluation efforts, Appraisals of leasehold positions in Hangars and other buildings, avigation easements and property for airport expansion. Improved and unimproved valuations have been performed for acquisitions in fee, leased fee and leasehold interests, and various partial interest assignments such as conservation easements, utility easements, subsurface, air rights and minority interest acquisitions. UASFLA-compliant Appraisals have been prepared for a wide variety of agencies on a wide range of property types. Mr. Brackett has qualified as an expert witness in King, Kitsap, Pierce County Superior Courts, US District Court and Federal Bankruptcy Court. Geographic experience includes Washington, Oregon, Idaho, California, Nebraska, Iowa, Kansas, South Dakota, Alaska and British Columbia. Clients Represented Government Cities: Anacortes, Arlington, Auburn, Bellevue, Bothell, Burien, Everett, Kenmore, Kent, Kirkland, Leavenworth, Lk Forest Park, Lynnwood, Maple Valley, Mount Vernon, North Bend, Port Angeles, Puyallup, Renton, Seattle, Snoqualmie, Tacoma, Woodinville. Counties: Island, King, Kitsap, Pierce, Skagit, Thurston, Snohomish, Whatcom Airports: Sea-Tac, Boeing Field, Paine Field, Renton Municipal, Auburn, Arlington, Bellingham, Olympia, William Fairchild, Sanderson Field, Felts Field, Centralia/Chehalis, Bremerton, Pullman, Orcas Island, Friday Harbor. Client Summary ‒ Various Cities ‒ Counties ‒ Airports ‒ Port Districts ‒ Financial Institutions ‒ Corporations/Non-Profits ‒ Conservation Entities ‒ Attorneys Education ‒ Bachelor degree in Business Administration from Western Washington University ‒ All courses requisite for the MAI designation by the Appraisal Institute. COML Council Packet 11-14-23, Page 119 of 277 2 ©2021 CBRE, INC. PROFILE Other: Ports of Everett, Grays Harbor, Anacortes, Seattle, Shelton, Olympia, Bremerton, Port Angeles, Friday Harbor. Washington State DNR, Wa.St. Parks, WSDOT (approved appraiser), U.S. IRS, FAA, Sound Transit, USACE, US Navy. Numerous School Districts. Financial Institutions Bank of America, US Bancorp, KeyBank, Wells Fargo Trust, Commerce Bank, Homestreet, Umpqua, Charter Bank, Union Bank. Corporations/NonProfits Weyerhaeuser, WRECO, Tramco, Plum Creek, McDonalds Corp., PSE, Development Services of America, Lowe Enterprises, PACCAR, Hancock Natural Resources Group, The Trust for Public Land, Forterra, HDR, Sierra Pacific, Quadrant, Port Blakely, CH2M-Hill, Parsons Brinckerhoff, New Ventures Group, Williams Pipeline, Manke lumber, Fletcher General, Costco, Nucor Steel. Attorneys Prosecuting Attorneys of numerous Cities and Counties, as well as Miller Nash, Williams & Williams, Karr Tuttle, Chmelik, Sitkin & Davis, PRK Livengood, Hillis Clark, Kenyon Disend, Perkins Coie, K&L Gates, Inslee Best, Tousley Brain Stephens, Davis Wright Tremaine, Pacifica Law Group, Betts Patterson Mines, Williams Kastner, Foster Garvey. Other Experience Instructor - Runstad Real Estate Certification Program, University of Washington – Current - IRWA – Previously Qualified as Level 3 Facilitator - Former Income Property Appraisal Course Instructor, LWVT, Kirkland, Wa. Presentations - November 2019: Anatomy of an Appraisal Trial, The Seminar Group -December 2014: Appraising Airports and Airplane Hangars, AI -September 2009: Valuation of Airport Properties, WAMA -October 2003: The Valuation of Non-Water Dependent Properties, WPMA Professional Affiliations - Appraisal Institute. Received MAI Designation May 2, 1997 (member # 11,258) -Past President, Seattle Chapter of the Appraisal Institute, 2003 -IRWA. Current Chapter Treasurer -Washington Airport Manager’s Association (WAMA) – Associate Member COML Council Packet 11-14-23, Page 120 of 277 Addenda S.MURRAY BRACKETT, MAI Valuation & Advisory Services 206-595-1068 Murray.Brackett@cbre.com Valuation & Advisory Services 206-292-6122 www.cbre.com CBRE VALUATION & ADVISORY SERVICES COML Council Packet 11-14-23, Page 121 of 277 RESOLUTION NO. 3968 A RESOLUTION DECLARING CITY OWNED REAL PROPERTY AS SURPLUS AND AUTHORIZING ITS SALE OR INTERGOVERNMENTAL TRANSFER Recitals: 1. The City of Moses Lake owns commercially zoned property which it no longer requiresand has identified as surplus. The property was acquired by the City of Moses Lake onAugust 26, 1946, from the Northern Pacific Railway Company. 2. The property is legally described as follows: LOT 1, MUNICIPAL TRACT 12 PLAT, PER THE PLAT THEREOF, RECORDED IN BOOK 13 OF PLATS, PAGES 49, RECORDS OF GRANT COUNTY WASHINGTON, IN THE NORTHEAST 1/4 SECTION 13, TOWNSHIP 19 NORTH, RANGE 28 EAST, W.M. MORE PARTICULARLY DESCRIBED AS FOLLOWS: COMMENCING AT THE NORTH 1/4 CORNER OF SAID SECTION; THENCE S00°35'04"E ALONG THE NORTH-SOUTH MID-SECTION LINE TO THE NORTHWEST CORNER OF SAID LOT 1, BEING THE POINT OF BEGINNING; THENCE CONTINUING S00°35'04"E ALONG SAID NORTH-SOUTH MID-SECTION LINE, 2638.32 FEET TO THE CENTER OF SAID SECTION, BEING THE SOUTHWEST CORNER OF SAID LOT 1; THENCE N89°51'37"E, 1554.63 FEET TO THE SOUTHEAST CORNER OF SAID LOT 1; THENCE N00°32'39"W, A DISTANCE OF 2560.50 FEET TO THE NORTHEAST CORNER OF SAID LOT 1; THENCE S89°47'05"W, A DISTANCE OF 1556.47 FEET TO THE NORTHWEST CORNER OF SAID LOT 1, BEING THE POINT OF BEGINNING. CONTAINING 94.25 ACRES, MORE OR LESS. Resolved: 1. The City of Moses Lake, Washington, declares that the real property listed above andowned by the City are surplus to its needs. 2. The real property described above can be disposed of and sold or transferred to an intergovernmental agency in a reasonable manner. Adopted by the City Council on November 14, 2023. _______________________________ Don Myers, Mayor COML Council Packet 11-14-23, Page 122 of 277 ATTEST: __________________________________________ Debbie Burke, City Clerk COML Council Packet 11-14-23, Page 123 of 277 COML Council Packet 11-14-23, Page 124 of 277 Council Staff Report To:Agenda Item Number: From Department For Agenda of:Proceeding Type Subject Reviewed and Approved by: Expenditure Required:Amount Budgeted:Appropriation Required: Action Requested Packet Attachments (if any) Overview Kevin Fuhr, City Manager 12981 Rich Huebner, Assistant City Manager Administration 11/14/2023 Consent Agenda Maple Road NE Water Main Break Emergency Resolution City Manager City Attorney Community Development Finance Fire Human Resources Parks, Rec, & Cultural Services Police Public Works Technology Services 110,000.00$0.00$110,000.00$ Move to adopt the Resolution affirming the City Manager's declaration of an emergency related to a water main break on Maple Road NE, and approve, confirm and ratify any and all actions taken by the City Manager in connection with this emergency prior to November 14, 2023. Maple Drive NE Water Main Break Emergency Resolution.pdf 70.96KB Maple Drive NE Water Main Break Emergency Budget Amendment.pdf 185.85KB Maple Drive NE Water Main Break Emergency Repair Capital Project Budget Report.pdf 143.5KB On Monday, October 30, 2023, City staff became aware of a water main break on Maple Drive NE, between Grape Drive NE & Hemlock Road, in front of 1121 Maple Drive. Upon inspection, staff determined that 14-inch C-905 water main had suffered a catastrophic failure. The ruptured pipe caused damage to approximately 6,867 square feet of Hot Mix Asphalt (HMA) surface treatment, approximately 50 feet of concrete curb and gutter, and approximately 26 feet of concrete driveway approach. The break also caused a delay in paving operations taking place in a new subdivision. The sudden catastrophic failure of a City water main was an unforeseen circumstance beyond the control of the City which created an emergency condition for the citizens of the City. The break presents a real, immediate threat to the health, safety, and welfare of the City of Moses Lake, including material loss and damage to property or bodily injury or harm. The "Expenditure Required" listed above is a project estimate. COML Council Packet 11-14-23, Page 125 of 277 Fiscal and Policy Implications Approve, Authorize, or Adopt: Provide Amended Direction: No Action Taken: There are sufficient unexpended monies available for repairs in the appropriate water and street accounts to complete the repairs. Options and Results Any uncompleted repairs prior to adoption of the resolution will be completed. N/A N/A COML Council Packet 11-14-23, Page 126 of 277 RESOLUTION NO. 3965 A RESOLUTION DECLARING THE EXISTENCE OF AN EMERGENCY AND WAIVING AND DISPENSING WITH THE STATUTORY COMPETITIVE BIDDING REQUIREMENTS Recitals 1. The City of Moses Lake is a code city operating under the authority of Chapter 35A RCW. 2. The City, under Title 35A.11 RCW and RCW 35A.13.230, has “… any authority ever given to any class of municipality or to all municipalities of this state…” 3. The City has the authority to commence a public work without complying with the statutory bid requirements in an emergency situation under the authority given by RCW 35.22.620(6), RCW 39.04.280, and other Washington law. 4. On Monday, October 30, 2023, City staff became aware of a water main break on Maple Drive NE, between Grape Drive NE & Hemlock Road. Upon inspection, staff determined that 14-inch C-905 water main had suffered a catastrophic failure. 5.The location of the failure was in front of 1121 Maple Drive. The ruptured pipe caused damage to approximately 6,867 square feet of Hot Mix Asphalt (HMA) surface treatment, approximately 50 feet of concrete curb and gutter, and approximately 26 feet of concrete driveway approach. 6. The break caused a delay in paving operations taking place in a new subdivision. 7. The sudden catastrophic failure of a City water main was an unforeseen circumstance beyond the control of the City which created an emergency condition for the citizens of the City. The break presents a real, immediate threat to the health, safety, and welfare of the City of Moses Lake, including material loss and damage to property or bodily injury or harm. 8. Therefore, an emergency exists, and complying with statutory bid requirements would unnecessarily delay the completion of repairs, and any increased costs associated with waiving the competitive bidding process will be outweighed by the costs associated with the delaying repairs. 9. There are sufficient unexpended monies available for repairs in the appropriate water and street accounts to complete the repairs. Resolved 1. An emergency exists due to the sudden catastrophic failure of a water main on Maple Drive NE, and it is imperative to implement a permanent repair as quickly as possible to preserve and protect the public’s health, safety, and welfare, and to prevent property damage and bodily injury. 2. Because an emergency exists, under the laws of the state of Washington, the statutory bid requirements are dispensed with and waived for water main repairs on Maple Drive NE. 3. This emergency condition was caused by the occurrence of a water main break on Maple Drive NE on October 30, 2023. Information has been delivered to Contractors in the area that are capable and qualified to perform this public work. Any and all actions taken by the City Manager prior to November 14, 2023 in connection with this emergency and roadway repair work, including the selection of any Contractors and the execution of any contracts and other necessary documents, are hereby approved, confirmed, and ratified. COML Council Packet 11-14-23, Page 127 of 277 Adopted by the City Council of the City of Moses Lake on November 14, 2023. _____________________________________ Don Myers, Mayor ATTEST: _____________________________________ Debbie Burke, City Clerk COML Council Packet 11-14-23, Page 128 of 277 Budget Adjustment Request Type of Adjustment* Instructions: If you are receiving additional revenues from an outside source (i.e. grant funds, donations, etc.) you must include the appropriate revenue code that the funds will be deposited to and the amount in the revenue section above. Enter the appropriate expenditure code/amount that the funds will be spent from in the expenditure section. The Use of Fund Balance will calculate automatically from the Revenue and Expenditure amounts entered. Fund*Department* Project/Grant Number Revenues If there are no Revenues, please enter '0' in each column. Fund*Dept *Object *Detail *Amount* Expenditures If there are no Expenditures, please enter '0' in each column. Fund*Dept *Object *Detail *Amount* Revenue Subtotal Expenditures Subtotal Use of Fund Balance Explanation* Amendment Transfer 119 - Street Repr/Recon 119 - Street Repr/Recon GC2023-183 Maple Drive Water Main Emergency Repairs If appropriate, please enter the Finance assigned Project/Grant Number. Budget Adjustment Details 0 ### 0 ### 0 3#### 0 #### 0.00$ 119 ### 119 ### 59530 5#### 0632 #### 110,000.00$ 0.00$ 110,000.00$ -110,000.00$ The project includes the removal and replacement of concrete sidewalk, curb, gutter, and hot mixed asphalt roadway that have been undermined and damaged due to a watermain break. Road subgrade shall be compacted and verified prior to repaving the road. Traffic control will be required to complete the project. Total project estimate comes in at $110,000 and due to the emergent need to repair the roadway before further damage occurs the City Manager has declared an emergency to address the situation. Funds would be coming from the 119 - Streets Repair and Reconstruction fund. COML Council Packet 11-14-23, Page 129 of 277 Project Budget Sheet/Other Supporting Document Name Signature* Submittal Date Submitter Email Is this being submitted by the City Manager, Assistant City Manager, or a Director?* Submitting Department* Division* 2023-11-01, GC2023-183 PB Maple Drive Emergency Repair.pdf 143.5KB Submitter Information Leigh Ramsey Please type your first and last name in the space above. Your typed first and last name will serve as your signature. Your signature signifies your acknowledgement of and agreement with the content of this form. 11/2/2023 lramsey@cityofml.com Yes No Public Works Engineering COML Council Packet 11-14-23, Page 130 of 277 Date:November 1, 2023 Project Number: Project Name: Public Impact:Personnel Impact: Regulation/Policy Change Needed?Legal Constraints? Viable Alternatives: Start Year: End Year: Total City Funding: Other Funding: 2023 2024 2025+ 2,000 2,000 - 100,000 100,000 7,000 7,000 1,000 1,000 Total Project Expenditures 110,000 - - - - 110,000 - - 2023 2024 2025+ Fund:119 - Streets 110,000 110,000 Fund:314 - Parks Improvement Fund:477 - Water/Sewer Const Fund:493 - Stormwater Fund:528 - Facilities Total Project Revenues 110,000 - - - - 110,000 - - Approved by City Council: 001 - General Fund - Date - - - - - GRANTS:- - 110,000 - - - Construction Engineering 7,000 - - Art Fund (if project cost is $75K+, add 1%)1,000 - Project Revenues by Category Original Budget Amend #1 Date Prior Years ESTIMATES Project TotalAmend #2 Date Amend #3 Date Design Engineering/Consultant 2,000 Right of Way Acquisition - Construction Contract 100,000 Project Notes: Project Expenditures by Category Original Budget Amend #1 Date Prior Years Spent ESTIMATES Project TotalAmend #2 Date Amend #3 Date Original Project Budget:$110,000 Budget Amendment:$0 Project Lead:Mark Beaulieu 2023 Assigned Department:Engineering 2023 Project Description:The project includes the removal and replacement of concrete sidewalk, curb, gutter, and hot mixed asphalt roadway that have been undermined and damaged due to a watermain break. Road subgrade shall be compacted and verified prior to repaving the road. Traffic control will be required to complete the project. Capital Project Budget GC2023-183 Maple Drive Water Main Emergency Repairs Dept/Category:Streets Failure to complete repairs to roadway could result in lack of connectivity. None None None None identified COML Council Packet 11-14-23, Page 131 of 277 Council Staff Report To:Agenda Item Number: From Department For Agenda of:Proceeding Type Subject Reviewed and Approved by: Expenditure Required:Amount Budgeted:Appropriation Required: Action Requested Packet Attachments (if any) Overview Fiscal and Policy Implications Approve, Authorize, or Adopt: Provide Amended Direction: Mayor and City Council 12960 Kevin Fuhr. City Manager Administration 11/14/2023 Consent Agenda Grant County Health District ILA City Manager City Attorney Community Development Finance Fire Human Resources Municipal Services Parks, Rec, & Cultural Services Police Technology Services 80,000.00$80,000.00$80,000.00$ Approve the attached Interlocal Agreement between the City of Moses Lake and the Grant County Health District. 2024 ILA Moses Lake.pdf 104.26KB MosesLake.2024.pdf 198.75KB MosesLake.KenisonFranz.Memo.pdf 861.91KB The City of Moses Lake and the Grant County Health District (GCHD) have had an Interlocal Agreement in place since 2005 in which the City provides financial contribution to the GCHD and in turn the GCHD provides public health services. The GCHD requested the City provide funding in the amount of $3.00 per capita, which equals $80,000.00 annually and an updated signed ILA with the City. The City budgeted the requested amount in the 2024 budget, and with council's approval, asks that the city manager be authorized to sign the updated ILA. The requested amount has been budgeted in the 2024 budget. Options and Results Approve and authorize the city manager to sign the ILA. Staff will bring back options for recommended changes.COML Council Packet 11-14-23, Page 132 of 277 No Action Taken: Not financially support the GCHD. COML Council Packet 11-14-23, Page 133 of 277 ILA GCHD_2024 CITY OF MOSES LAKE PER CAPITA 1 of 4 INTERLOCAL AGREEMENT BETWEEN THE GRANT COUNTY HEALTH DISTRICT AND THE CITY OF MOSES LAKE PER CAPITA CONTRIBUTION FOR HEALTH DISTRICT SERVICES This Interlocal Agreement for Per Capita Contribution for Health District Services is entered into by and between the GRANT COUNTY HEALTH DISTRICT, a Washington Municipal Corporation (the District) and CITY OF MOSES LAKE a municipal corporation of the State of Washington (the City) – collectively (the Parties), for the purpose of providing for a per capita contribution by the City for Health District Services. RECITALS WHEREAS, This Agreement is made pursuant to the Interlocal Cooperation Act, Chapter 39.34 RCW; and WHEREAS, to promote the public health in Grant County, Washington, the Board of County Commissioners of Grant County, Washington, established a Health District on in 1967, embracing all of the territory within Grant County, Washington, and all cities and towns therein; and WHEREAS, in 1967 the Grant County Health District became a public health program with cities indicating a willingness to participate on the Grant County Board of Health; and WHEREAS, in 1993, counties assumed exclusive financial responsibility for public health relying on Motor Vehicle Excise Tax (MVET) revenues; and WHEREAS, in 2000, the Washington State Legislature repealed MVET and backfilled only 90% of lost public health funds; and WHEREAS, on January 1, 2005, 7 of 14 cities and towns agreed to voluntarily contribute $1.00 per capita to the Health District in return for public health services; and WHEREAS, prior to the COVID Pandemic, 12 of 13 cities and towns agreed to voluntarily contributed $1.00-$4.00 per capita to the Health District in return for public health services; and WHEREAS, in 2023 Grant County Board of County Commissioners contributed $171,910 and Grant County cities and towns voluntarily contributed $139,585 to the Health District in return for public health services; and WHEREAS, the Health District’s ability to perform its most essential functions have been severely compromised since the great recession; and WHEREAS, the Health District serves an essential public safety function whether ensuring safe food, schools, and septic systems, responding to disasters, or preventing and responding to disease outbreaks; and WHEREAS, threats to the public’s health in the form of foodborne illness such as E.coli and salmonella, communicable diseases such as pertussis, tuberculosis, measles, and Ebola and natural disasters such as response to annual wildfire smoke respect no municipal boundaries; and WHEREAS, public health is a shared responsibility and regional public health threats require regional responses and close partnerships with every city and town in Grant County; and WHEREAS, consistent with RCW 70.05, the Grant County Board of County Commissioners is responsible for establishing the Grant County Board of Health, with jurisdiction coextensive with the COML Council Packet 11-14-23, Page 134 of 277 ILA GCHD_2024 CITY OF MOSES LAKE PER CAPITA 2 of 4 boundaries of the county, to supervise all matters pertaining to the preservation of life and health of the people within its jurisdiction; and WHEREAS, an effective, regional public health response to the threats to public health in Grant County requires the cooperation, participation and support of Grant County and all of the cities and towns in Grant County; and WHEREAS, Grant County and the cities and towns therein seek to improve and sustain healthy years of life of their residents by engaging in an enhanced partnership with the Health District. This partnership will provide stable funding for public health priorities that would be established to meet the unique needs of each community. NOW, THEREFORE, in consideration of the agreements set forth below and for other good and valuable consideration, the receipt and sufficiency of which are hereby acknowledged, the City and the Health District agree as follows: 1. Purpose. A.The recitals set forth above are incorporated herein by this reference. B.The purpose of this Agreement is to establish and define the terms and conditions for the cooperative efforts to be undertaken by the City and the Health District to promote, facilitate, and undertake various programs and activities. 2. Term. The term of this Agreement shall be from January 1, 2024, to December 31, 2024. The term may be extended by mutual written agreement of the parties. 3. Scope of Services. A.Responsibilities of the City. The City shall contribute $3.00 annually to the Health District commencing January 1, 2024. Payments may be made in one lump sum annually, preferably on or before June 30 of each year. B.Responsibilities of the Health District. An invoice will be sent to the city after the first of the year. The Health District shall provide basic essential public health services and functions such as ensuring safe food, inspecting septic systems, responding to disasters, or preventing and responding to disease outbreaks. The Health District will partner with the City to coordinate childhood injury prevention, substance use related training, and community outreach events. The Health District will provide reports to the city identifying services provided to City residents and businesses. Additional specific services provided by the Health District to the City may be developed jointly by the parties. 4. Legal Requirements. Both parties shall comply with all applicable federal, state, and local laws in performing this Agreement. 5. Public disclosure laws. The City and the District each acknowledge, agree, and understand that the other party is a public agency subject to certain disclosure laws, including, but not limited to Washington’s Public COML Council Packet 11-14-23, Page 135 of 277 ILA GCHD_2024 CITY OF MOSES LAKE PER CAPITA 3 of 4 Records Act, chapter 42.56 RCW. Each party understands that records related to this Agreement and the District’s performance of services under this Agreement may be subject to disclosure pursuant to the Public Records Act or other similar law. 6. Insurance. Each party shall maintain its own insurance and/or self-insurance for its liabilities from damage to property and /or injuries to persons arising out of its activities associated with this Agreement as it deems reasonably appropriate and prudent. The maintenance of, or lack thereof of insurance and/or self-insurance shall not limit the liability of the indemnifying part to the indemnified party(s). Each party shall provide the other with a certificate of insurance or letter of self-insurance upon request. 7. Indemnification. The District shall protect, save harmless, indemnify and defend the City its elected officials, officers, employees and agents, from and against any loss or claim for damages of any nature whatsoever, including claims by third parties or District employees against which it would otherwise be immune under Title 51 RCW or other law, arising out of any act or omission of the District in performance of this Agreement, its elected or appointed officials, officers, employees or agents, except to the extent the loss or claim is attributable to the negligence or willful misconduct of the City, its elected officials, officers, employees or agents. The City shall protect, save harmless, indemnify and defend the District, its elected and appointed officials, officers, employees and agents from and against any loss or claim for damages of any nature whatsoever, including claims by third parties or City employees against which it would otherwise be immune under Title 51 RCW or other law, arising out of any act or omission of the City in performance of this Agreement, its elected or appointed officials, officers, employees or agents, except to the extent the loss or claim is attributable to the negligence or willful misconduct of the District, its elected or appointed officials, officers, employees or agents. 8. Notices. Any notice/payment to be given to the District under this Agreement shall be either mailed or personally delivered to: Grant County Health District 1038 W Ivy Ave. Suite 1 Moses Lake, WA 98837 Any notice/invoice to the City shall be mailed or hand delivered to: City of Moses Lake PO BOX 1579 MOSES LAKE WA 98837 Receipt of any notice shall be deemed effective three (3) days after deposit of written notice in the U.S. mail with proper postage and address. 9. Venue. The laws of the State of Washington shall apply to the construction and enforcement of this Agreement. Any action at law, suit in equity, or judicial proceedings for the enforcement of this agreement or any provision hereto shall be in the Superior Court of Grant County, Ephrata, Washington. 10. Disputes. The parties agree that, following reasonable attempts at negotiation and compromise, any unresolved dispute arising under this Agreement may be resolved by a mutually agreed-upon alternative dispute resolution of arbitration or mediation. COML Council Packet 11-14-23, Page 136 of 277 ILA GCHD_2024 CITY OF MOSES LAKE PER CAPITA 4 of 4 11.No third-party beneficiaries; no joint venture. This Agreement is for the sole benefit of the City and District and shall not confer third-party beneficiary status on any non-party to this Agreement. Nothing contained in this Agreement shall be construed as creating any type or manner of partnership, joint venture or other joint enterprise between the parties. Health District employees who provide services under this Agreement shall at all times be acting in their official capacities as employees of Grant County Health District. 12.Entire Agreement. This Agreement constitutes the entire agreement between the parties regarding the subject matter hereof and supersedes any and all prior oral or written agreements between the parties regarding the subject matter contained herein. This Agreement may not be modified or amended in any manner except by written agreement executed by both parties. Both parties recognize that time is of the essence in the performance and the provisions of this Agreement. 13.Severability. A.If a court of competent jurisdiction holds any part, term or provision of this Agreement to be illegal or invalid, in whole or in part, the validity of the remaining provisions shall not be affected, and the parties’ rights and obligations shall be construed and enforced as if the Agreement did not contain the particular provision held to be invalid. B.If any provision of this Agreement is in direct conflict with any statutory provision of the State of Washington, that provision which may conflict shall be deemed inoperative and null and void insofar as it may conflict and shall be deemed modified to conform to such statutory provision. 14.Filing. As provided by RCW 39.34.040, this Agreement shall be filed with the Grant County Auditor, or, alternatively, posted on the website of each party. 15.Execution in Counterparts. This Agreement may be executed in two or more counterparts, each of which shall constitute an original and all of which shall constitute one and the same agreement. 16.Effective Date. January 1, 2024 MOSES LAKE Grant County Health District Kevin Fuhr, City Manager Theresa Adkinson, Administrator ATTEST: ATTEST: City Clerk Clerk of the Board of Health Approved as to Form: Approved as to Form: City Attorney Health District Attorney COML Council Packet 11-14-23, Page 137 of 277 1038 West Ivy, Suite 1 Moses Lake, WA 98837 Phone: 509-766-7960 ⚫ FAX: 509-766-6519 ⚫ granthealth.org October 25, 2023 Dear Mayor Myers and Interim City Manager Fuhr City of Moses Lake I truly hope this letter finds you well. I want to start this letter by thanking you for your 2023 financial contribution to the Grant County Health District. As we reflect on the work that has been done in the past year and prepare for the excitement and inventible challenges of 2024, your continued contribution will help provide the necessary support for our public health team to assist Grant County to the best of our ability. The generous contributions from our cities, towns, and county in 2023 assisted the Health District to respond quickly and efficiently to essential public health matters. By continuing your contribution for 2024 you are actively supporting GCHD's ability to identify and respond to the public health needs that are specific to our communities. With rising demands and costs for our public health services we are asking for a contribution of $3 per resident. In addition to those services required under state law, Grant County Health District provides communicable disease-specific response, local coalition participation, school-based health presentations, solid waste consultations, grant writing assistance, participate in community health fairs, provide trainings, group facilitation, assessment and surveys, and healthy community projects. Your support through this agreement allows us to provide the services and expertise needed to prevent diseases and injuries and make your community safer and healthier. 2023 has been a year filled with both challenges and excitement. Staff have had the opportunity to expand programs and work directly with Grant County communities in a capacity that was not possible before for our local health district! We have a deep appreciation for the financial challenges facing our cities, towns, and county and strongly consider public health to be a sound investment for your community. If you find the accompanying Interlocal Agreement suitable, please sign two copies and return them to Rita Morfin, Administrative Services at 1038 W Ivy Avenue, Suite #1, Moses Lake, WA 98837 and an invoice will be sent to you after the first of the year. If you need to modify the amount of funding committed, please do so, and an updated Interlocal Agreement will be sent along with the invoice. We look forward to serving you in this joint effort to keep our citizens safe and healthy. If you have any questions or would like to meet, please contact me at tadkinson@granthealth.org or at (509) 766-7960 ext. 24. Sincerely, Theresa Adkinson, Administrator GCHD’s mission is to evaluate the health of Grant County and align opportunities for our communities to thrive and be healthy. COML Council Packet 11-14-23, Page 138 of 277 COML Council Packet 11-14-23, Page 139 of 277 COML Council Packet 11-14-23, Page 140 of 277 COML Council Packet 11-14-23, Page 141 of 277 Council Staff Report To:Agenda Item Number: From Department For Agenda of:Proceeding Type Subject Reviewed and Approved by: Expenditure Required:Amount Budgeted:Appropriation Required: Action Requested Packet Attachments (if any) Overview Fiscal and Policy Implications Approve, Authorize, or Adopt: Kevin Fuhr, City Manager 13011 Brett Bastian Fire 11/14/2023 Consent Agenda Moses Lake School District Fire Science Equipment ILA City Manager City Attorney Community Development Finance Fire Human Resources Parks, Rec, & Cultural Services Police Public Works Technology Services 0.00$0.00$0.00$ Approve execution of the interlocal agreement with Moses Lake School District 161 enabling shared usage of Reserve Fire Engine 5. INTERLOCAL_MLSD_Engine.docx 18.38KB The Moses Lake School District has offered a course of instruction in Fire Science at the Columbia Basin Technical Skills Center. This course of instruction has potential benefit to the City of Moses Lake in providing training that could lead to employment with the Moses Lake Fire Department. Currently the school does not have access to fire apparatus that would provide real world "hands-on" training for the students. The Moses Lake Fire Department has one reserve fire engine, Engine 5, that is currently stored outside and unprotected from the elements at the City Shop complex as there is no space for indoor storage at existing City facilities. The interlocal agreement would move the engine to school district property and allows the unit to be stored under cover in a secured, fenced enclosure. Students would have access to use the engine in static training environments that would be beneficial to the students. Members of the fire department or fleet management would have access to the unit at any time, day or night, if the unit was needed to temporarily replace a front line unit. None. Options and Results Allows use of Engine 5 by the Moses Lake School District for training at the Columbia Basin Technical Skills Center for students enrolled in the Fire Science program.COML Council Packet 11-14-23, Page 142 of 277 Provide Amended Direction: No Action Taken: Staff will bring back options for recommended changes. The department would not enter into an interlocal agreement with the School District, students would not have access to the reserve engine for training, and the unit would remain in reserve status at the City Shop complex. COML Council Packet 11-14-23, Page 143 of 277 Interlocal Agreement THIS AGREEMENT is between CITY OF MOSES LAKE, a non-charter code city of the State of Washington, and Moses Lake School District #161, a public agency. WITNESSETH: WHEREAS, the lnterlocal Cooperation Act, as amended, and codified in Chapter 39.34 of the Revised Code of Washington provides for interlocal cooperation between governmental agencies; and WHEREAS, The City of Moses Lake maintains a fleet of fire apparatus for response to emergencies that includes reserve apparatus; and WHEREAS, Moses Lake School District #161 operates a course of instruction in Fire Science that benefits students residing within the City Limits of Moses Lake and Grant County; and WHERAS, the Fire Science program benefits the City of Moses Lake by generating potential employees for hire in the Moses Lake Fire Department. NOW, THEREFORE, the parties agree as follows: 1. EQUIPMENT RENTAL: Moses Lake shall make its vehicle #241, a 2001 Emergency One Class A Fire Engine, currently operated as a reserve engine with the City of Moses Lake Fire Department, available to the Moses Lake School District #161 for static site training of fire science students at Columbia Basin Technical Skills Center. 2. CONSIDERATION: In consideration for the School Fire Science program’s generating potential local candidates for employment by the Moses Lake Fire Department, School shall not be required to pay any rental fees. 3. ADMINISTRATION: No special budget or funds are anticipated, nor shall be created under this agreement. It is not intended that a separate legal entity be established to conduct this cooperative undertaking, nor is the acquisition, holding, or disposing of any real or personal property other than as specifically provided for under the terms of this Agreement anticipated. Moses Lake shall be designated as the Administrator of this Agreement. 4. SCOPE: This agreement shall allow the following activities: A. Instructors of the Columbia Basin Technical Skills Center employed by Moses Lake School District #161 shall have access to reserve Engine 5 of the Moses Lake Fire Department; COML Council Packet 11-14-23, Page 144 of 277 B. Only personnel who are qualified driver operators possessing a Washington State Commercial Drivers License, or who are authorized to operate fire apparatus under the Washington State Emergency Vehicles Incident Prevention Program, (EVIP), shall operate the apparatus. C. The apparatus shall not be operated on any public street or highway by anyone other than employees of the City of Moses Lake Fire or Fleet Management departments. D. Moses Lake School District #161 agrees to maintain the reserve unit in fenced and locked enclosure under roof cover. Locked enclosures shall be accessible either through use of a Knox padlock keyed to the Moses Lake Fire Department Knox access system, or maintenance of keys in the Knox box located at the facility. E. Equipment maintained on the reserve unit may also be utilized by students under direct supervision of the Fire Science Instructors of Columbia Basin Technical Skills Center. F. Any damage to the reserve unit or equipment maintained on the unit while being used by Moses Lake School District #161 shall be repaired or replaced at the sole expense of Moses Lake School District #161. G. Moses Lake School District #161 agrees to provide access to the reserve unit by members of the Moses Lake Fire Department or Moses Lake Fleet Management Department at any time of the day or night, 7 days a week, 365 days a year. H. Moses Lake School District #161 agrees that the reserve unit and / or equipment maintained on the unit may be required to be pressed into front line service by the City of Moses Lake with little or no notice and for unknown periods of time. I. Moses Lake School District #161 agrees that the reserve unit shall remain plugged into shore power while in storage, and that the pump shall be properly drained and winterized if the unit is stored outside during below freezing weather conditions. 5. DURATION AGREEMENT-TERMINATION: This Agreement shall commence upon the execution of this Agreement and filing or posting of this Agreement in accordance with Chapter 39.34 RCW and shall terminate when canceled by either party in writing. Either party may terminate this agreement by providing written notice to the other Party at least thirty (30) days prior to the date of termination. 6. INSURANCE: Each party shall maintain in effect insurance with limits in the amount each Party currently has in place. COML Council Packet 11-14-23, Page 145 of 277 7. INDEMNIFICATION: Each party agrees to be responsible and assume liability for its own wrongful or negligent acts or omissions or those of their officials, officers, agents, or employees to the fullest extent required by law, and further agrees to save, indemnify, defend, and hold the other party harmless from any such liability. It is further provided that no liability shall attach to Moses Lake by reason of entering into this Agreement except as expressly provided herein. 8. NOTICES: All notices and demands shall be in writing and sent to the Parties at the respective address as follows: TO MOSES LAKE TO SCHOOL Brett Bastian Jeremy O’Neil Moses Lake Fire Chief Chief Operations Officer 411 S Balsam St 1620 S. Pioneer Way PO Box 1579 Moses Lake, WA 98837 Moses Lake WA 98837 9. DISPUTE RESOLUTION: The Parties agree to attempt to resolve any disputes relating to the interpretation or application of this Agreement informally through discussions at the staff level. The venue for any action to enforce or interpret this Agreement shall lie in the Superior Court for Grant County, Washington. 10. RIGHT TO CONTRACT INDEPENDENT ACTION PRESERVED: Each party reserves the right to contract independently for the acquisition of goods or services or disposal of any property without notice to the other party and shall not bind or otherwise obligate the other party to participate in the activity. 11. COMPLIANCE WITH LEGAL REQUIREMENTS: Each party accepts responsibility for compliance with federal, state, or local laws and regulations. 12. FILING: Executed copies of this agreement shall be filed or posted on a website as required by Section 39.34.040 of the Revised Code of Washington prior to this agreement becoming effective. 13. NON-DELEGATION/NON-ASSIGNMENT: Neither party may delegate the performance of any contractual obligation, to a third party, unless mutually agreed in writing. Neither party may assign this agreement without the written consent of the other party. 14. HOLD-HARMLESS: Each party shall be liable and responsible for the consequence of any negligent or wrongful act or failure to act on the part of itself and its employees. Neither party assumes responsibility to the other COML Council Packet 11-14-23, Page 146 of 277 party for the consequences of any act or omission of any person, firm, or corporation not a party to this agreement. 15. SEVERABILITY: Any provision of this agreement, which is prohibited or unenforceable, shall be ineffective to the extent of such prohibition or enforceability, without involving the remaining provisions or affecting the validity or enforcement of such provisions. City of Moses Lake Moses Lake School District #161 By:_________________________ By:_______________________________ Kevin Fuhr, City Manager Jeremy O’Neil, Chief Operations Officer Date_____________________ Date__________________ COML Council Packet 11-14-23, Page 147 of 277 &RXQFLO6WDII5HSRUW 7R$JHQGD,WHP1XPEHU )URP 'HSDUWPHQW )RU$JHQGDRI3URFHHGLQJ7\SH 6XEMHFW 5HYLHZHGDQG$SSURYHGE\ ([SHQGLWXUH5HTXLUHG$PRXQW%XGJHWHG$SSURSULDWLRQ5HTXLUHG $FWLRQ5HTXHVWHG 3DFNHW$WWDFKPHQWV LIDQ\ )LVFDODQG3ROLF\,PSOLFDWLRQV $SSURYH$XWKRUL]HRU$GRSW .HYLQ)XKU&LW\0DQDJHU  %ULDQ%DOW]HOO'LUHFWRU 3XEOLF:RUNV &RQVHQW$JHQGD $FFHSW0LQL6WRUDJH:DWHU([WHQVLRQ,PSURYHPHQWV5HVROXWLRQ &LW\0DQDJHU &LW\$WWRUQH\ &RPPXQLW\'HYHORSPHQW )LQDQFH )LUH +XPDQ5HVRXUFHV 3DUNV5HF &XOWXUDO6HUYLFHV 3ROLFH 3XEOLF:RUNV 7HFKQRORJ\6HUYLFHV  6WDIIUHFRPPHQGV&LW\&RXQFLODGRSWWKHUHVROXWLRQDVSUHVHQWHG 0DLQWHQDQFH%RQGLQJ&DOFXODWLRQVSGI .% 0%%'DQ2OLQ5$0052$'0,1,6725$*(6+7WLI 0LQL6WRUDJH5HVROXWLRQWRDFFHSW LPSURYHPHQWVGRF[ 2YHUYLHZ .% 7KHSODWWLQJUHJXODWLRQVUHTXLUHDOOWKHVWUHHWDQGXWLOLW\LPSURYHPHQWVLQVWDOOHGLQULJKWRIZD\DQGPXQLFLSDO HDVHPHQWVWREHDFFHSWHGE\&LW\&RXQFLORUERQGHGIRUSULRUWRUHFRUGLQJWKHSODWDQGLVVXLQJEXLOGLQJSHUPLWV 7KHFRQVWUXFWLRQSODQVDUHUHTXLUHGWREHUHYLHZHGDQGDSSURYHGE\WKH&LW\SULRUWRFRQVWUXFWLRQ$OOWKH FRQVWUXFWLRQZRUNLVLQVSHFWHGWRDVVXUHFRPSOLDQFHZLWKWKHFRQVWUXFWLRQSODQVDQGFLW\VWDQGDUGV7KHZDWHU PDLQH[WHQVLRQLQSODFHZLOOVHUYHDPLQLVWRUDJHIDFLOLW\DQGDOVRDFWDVDFRQQHFWLRQSRLQWIRUIXWXUHH[WHQVLRQ RIWKHPXQLFLSDOZDWHUPDLQ 8SRQDFFHSWDQFHWKH&LW\ZLOOEHUHVSRQVLEOHIRUWKHPDLQWHQDQFHDQGUHSDLUVRIWKHLPSURYHPHQWV$ 68%',9,6,210$,17(1$1&(%21'RURWKHUDSSURYHGVHFXULW\LQWKHDPRXQWRI RIWRWDO FRVWVRI WRWKH&LW\LVUHTXLUHGWREHSURYLGHGE\WKHRZQHUVIRUWKHWZR\HDUPDLQWHQDQFHSHULRG ZKLFKFRPPHQFHVRQWKHGDWHRIDFFHSWDQFHRIWKHLPSURYHPHQWVE\WKH&LW\&RXQFLO 2SWLRQVDQG5HVXOWV 7KHLPSURYHPHQWVZLOOEHDFFHSWHGDQGWKHSODWFDQEHFRPSOHWHG COML Council Packet 11-14-23, Page 148 of 277 3URYLGH$PHQGHG'LUHFWLRQ 1R$FWLRQ7DNHQ $FWLRQZRXOGUHTXLUH6WDIIWREULQJDUHYLVHGUHVROXWLRQWR&RXQFLOIRUFRQVLGHUDWLRQ 7KH&LW\ZLOOQRWDFFHSWWKHSODWLPSURYHPHQWVDQGWKHSODWFRXOGQRWEHFRPSOHWHG COML Council Packet 11-14-23, Page 149 of 277 Olin Development Mini Storages Jared Olin UNIT QTY UNIT PRICE TOTAL 1. Mobilization Mobilization LS 1 17,500.00$ 17,500.00$ Subtotal 17,500.00$ 2. Storm Drain System 10" PVC storm LF 518 56.00$ 29,008.00$ Dry Well Type A EA 3 5,150.00$ 15,450.00$ Dry Well Type B EA 1 5,700.00$ 5,700.00$ Catch Basin Type 1 EA 7 2,400.00$ 16,800.00$ Subtotal 66,958.00$ 3. Water System 8" PVC Watermain including fittings LF 1,000 49.00$ 49,000.00$ Hydrant Assembly EA 6 5,875.00$ 35,250.00$ Water Services EA 1 2,615.00$ 2,615.00$ 10" PVC Watermain including fittings LF 620 59.00$ 36,580.00$ Subtotal 123,445.00$ 4. Sitework HMA SF 85,280 2.20$ 187,616.00$ Top Course TON 3,112 28.00$ 87,136.00$ Grading/stripping topsoil CY 3,064 4.50$ 13,788.00$ Subgrade prep SF 85,280 0.40$ 34,112.00$ Swale LS 1 5,000.00$ 5,000.00$ Subtotal 327,652.00$ 5. Traffic Control Traffic Control LS 1 1,500.00$ 1,500.00$ Subtotal 1,500.00$ 6. Erosion Control Construction Entrance LS 1 3,500.00$ 3,500.00$ Subtotal 3,500.00$ Subtotal 540,555.00$ Sales tax on items 1,3 @ (8.2%)11,557.49$ Total 552,112.49$ Price to exclude: Hydroseeding lots, Surveying, Construction Permit, Fees, Material Testing, Rock Excavation, dewatering, dry utilities, and bonding. 2.20SF LF 49.000 $ $ EA 5,875.00$ 8" Water Main installed in ROW 464' @ $49 per foot $22,736.00 Municipal Fire Hydrant 1 @ $5,875 $5,875.00 HMA 6,026 sf @ $2.20 per square foot + $13,257.20 $41,868.20 X 50% Maintenance Bonding Required $20,934.10 COML Council Packet 11-14-23, Page 150 of 277 COML Council Packet 11-14-23, Page 151 of 277 RESOLUTION NO. 3967 A RESOLUTION ACCEPTING STREET AND UTILITY IMPROVEMENTS FOR MUNICIPAL USE AS A PART OF THE DAN OLIN RAMM ROAD MINI-STORAGE Recitals: 1. Street and Utility improvements lying in dedicated right-of-way or easements are in place and connected to the City of Moses Lake’s water utility systems as part of Dan Olin Ramm Road Mini-Storage. The project includes water main improvements to Ramm Road. 2. Said street and utility improvements have been installed in accordance with the City of Moses Lake’s Community Standards and were completed in November of 2023. 3. RCW 35.90.030, indicates that developer installed public street and utility facilities, should be accepted by the City of Moses Lake upon completion if the facilities are built to city standards. 4. A Subdivision Maintenance Bond shall be provided by the developer for a two-year maintenance period which commences on November 14, 2023 Resolved: 1. The City Council of the City of Moses Lake accepts the Dan Olin Mini-Storage water main utility improvements to Ramm Road as facilities of the City of Moses Lake and as such will charge for use of facilities as authorized by ordinance. 2. After November 14, 2023, all operational costs of the said street and utility improvements shall be borne by the City of Moses Lake as provided by city ordinance and subject to the required maintenance bond. 3. Subject to final inspection, after November 15, 2025, all further maintenance, and operational costs of said street and utility improvements shall be borne by the City of Moses Lake, as provided by city ordinance. ACCEPTED by the City Council on November 14, 2023. ______________________________ Don Myers, Mayor ATTEST: _______________________________ Debbie Burke, City Clerk COML Council Packet 11-14-23, Page 152 of 277 Council Staff Report To:Agenda Item Number: From Department For Agenda of:Proceeding Type Subject Reviewed and Approved by: Expenditure Required:Amount Budgeted:Appropriation Required: Action Requested Packet Attachments (if any) Overview Fiscal and Policy Implications Approve, Authorize, or Adopt: Kevin Fuhr, City Manager 13112 Brian Baltzell, Director Public Works 11/14/2023 Consent Agenda SR-17 and Stratford Rd Pedestrian Safety Grant City Manager City Attorney Community Development Finance Fire Human Resources Parks, Rec, & Cultural Services Police Public Works Technology Services 685,088.00$685,088.00$0.00$ Staff recommends City Council motion to accept Pedestrian and Bicycle funding in the amount of $685,088.00 SR-17 & Stratford Road Interchange Ped Improvement 2023-25 Ped & Bike Safety Program Funding Letter.pdf 380.55KB SR-17_STRATFORD Interchange Project.pdf 488.53KB In 2022, staff applied for a Pedestrian and Bicycle Safety grant; we were notified of award in May 2023 and have been working with WSDOT Local Programs to execute the applicable agreement(s). We are requesting Council give formal authorization for project expenditures and commence work associated with the project including authorizing the City Manager to execute the necessary agreements with state agencies. This DDO (develop/design only) Pedestrian and Bicycle Safety grant is a reimbursable, no match grant totaling $685,088. There were no funds budgeted for this project in 2023, but we expect initial staff time to seek advertisements to amount to less than $10,000. This project is included in the 2024 Capital Improvement Plan budget list for planning and design contract with external consultant. N/A Options and Results Funds will be accepted and staff will work on SR-17 & Stratford Road Improvement project. COML Council Packet 11-14-23, Page 153 of 277 Provide Amended Direction: No Action Taken: Staff will bring back options for recommended changes. Grant funds will not be accepted and utilized. COML Council Packet 11-14-23, Page 154 of 277 COML Council Packet 11-14-23, Page 155 of 277 COML Council Packet 11-14-23, Page 156 of 277 COML Council Packet 11-14-23, Page 157 of 277 COML Council Packet 11-14-23, Page 158 of 277 Council Staff Report To:Agenda Item Number: From Department For Agenda of:Proceeding Type Subject Reviewed and Approved by: Expenditure Required:Amount Budgeted:Appropriation Required: Action Requested Packet Attachments (if any) Overview Fiscal and Policy Implications Approve, Authorize, or Adopt: Kevin Fuhr, City Manager 13111 Brian Baltzell, Director Public Works 11/14/2023 Consent Agenda Safe Routes to Schools Nelson Road Grant City Manager City Attorney Community Development Finance Fire Human Resources Parks, Rec, & Cultural Services Police Public Works Technology Services 2,206,937.00$2,206,937.00$0.00$ Staff recommends City Council motion to accept Safe Routes to School funding in the amount of $2,206,907.00. Nelson Road Corridor Ped Improvement 2023-25 SRTS Funding Letter.pdf 335.97KB In 2022, staff applied for a Safe Routes to School Grant; we were notified of award in May 2023 and have been working with WSDOT Local Programs to execute the applicable agreement(s). We are requesting Council give formal authorization for project expenditures and commence work associated with the project, including authorizing the City Manager to execute the necessary agreements with state agencies. This SRTS grant is a reimbursable, no match grant totaling $2,206,937. No further funds are required beyond the 2023 budgeted amount of $200,000. This project is included in the 2024 Capital Improvement Plan (CIP) budget list for continued design engineering with construction estimated to begin in 2025. N/A Options and Results Funds will be accepted and staff will work on Nelson Road Corridor Safe Routes to School Project. COML Council Packet 11-14-23, Page 159 of 277 Provide Amended Direction: No Action Taken: Staff will bring back options for recommended changes. Grant funds will not be accepted and utilized. COML Council Packet 11-14-23, Page 160 of 277 COML Council Packet 11-14-23, Page 161 of 277 COML Council Packet 11-14-23, Page 162 of 277 COML Council Packet 11-14-23, Page 163 of 277 Council Staff Report To:Agenda Item Number: From Department For Agenda of:Proceeding Type Subject Reviewed and Approved by: Expenditure Required:Amount Budgeted:Appropriation Required: Action Requested Packet Attachments (if any) Kevin Fuhr, City Manager 13125 Rich Huebner, Assistant City Manager Administration 11/14/2023 Consent Agenda Municipal Airport Operations Building Use Fees City Manager City Attorney Community Development Finance Fire Human Resources Parks, Rec, & Cultural Services Police Public Works Technology Services 0.00$0.00$0.00$ Move to approve the Municipal Airport Commission's recommended use fees for the Municipal Airport Operations Building. 10-05-2023 Staff Report re Ops Bldg.pdf 199.26KB 10-31-2023 Staff Report re Ops Bldg.pdf 413.02KB COML Council Packet 11-14-23, Page 164 of 277 Overview Fiscal and Policy Implications Approve, Authorize, or Adopt: Provide Amended Direction: No Action Taken: In discussion at a recent meeting of the Municipal Airport Commission, it has become known to staff that there are three non-profit community groups that have been using the Operations Building at the Moses Lake Municipal Airport free of charge. Because this is a publicly owned building on publicly owned land, continued free usage would constitute an unlawful gifting of public funds. When this issue was presented to the Airport Commission, commissioners supported establishing a nominal fee that would be reflective of the cost to operate the building during the times these groups are using it. Public Works Accountant Leigh Ramsey completed an analysis of the cost of renting the building for meetings and/or events. Leigh's analysis considered the average hourly and annual cost of utilities and services, including power, water, maintenance, and janitorial supplies and service. Leigh's findings produced a recommendation of an annual charge of $55, which would allow a group to use the building once a month for one hour, as well as an average hourly cost of $4.00. These fees were adopted for recommendation to the City Council by the Airport Commission at its October 5, 2023 meeting. At the October 5 meeting, the Commission also requested staff to analyze and recommend a separate rate for use of the building for single use events. Leigh Ramsey again conducted the analysis, and provided a recommendation of $26.50 for the first hour, plus $4.00 for each additional hour, which will cover the cost of power, water, maintenance, and janitorial supplies and service for one-time use events. These fees were adopted for recommendation to the City Council by the Airport Commission at its November 2, 2023 meeting. The staff reports prepared by Leigh Ramsey and presented to the Airport Commission at its October 5 and November 2 meetings are attached. It is the recommendation of the City Manager that the City Council adopt the recommended fees, which will be added into the City's existing facility use form. While adoption of the fees is likely to result in additional revenue for the airport fund, the anticipated revenue increase is nominal. Options and Results The fees will be added to the City's facility use form and become effective upon adoption by the City Council. Staff will bring back options for recommended changes. The City will risk an audit finding for gifting of public funds. COML Council Packet 11-14-23, Page 165 of 277 STAFF REPORT To: Moses Lake Municipal Airport Commission From: Leigh Ramsey, Public Works Accountant Cc: Rich Huebner, Assistant City Manager Date: October 2, 2023 Re: Recommended Rental Rate for Operations Building At the August 3rd, 2023, Commission meeting city staff were asked to complete an analysis of the costs associated with renting the operations building for meetings and/or events. The analysis consisted of reviewing the operations building utility costs (water and power), cost of janitorial supplies, janitorial staff time, and maintenance staff time. The results of that analysis are listed below: Based on the data reviewed, City staff recommend charging an annual rental rate of $55.00, at minimum, which would allow for use of the operations building one time per month for one hour. Name Type of Service Average Daily Cost Average Hourly Cost Recommended Annual Charge Comments/Notes Grant County PUD Power 3.58$ 0.30$ 3.60$ Ops building only. City of Moses Lake Water 2.94$ 0.25$ 3.00$ Ops building only; irrigation meter not considered. Usage of outdoor space could warrant increased cost. 6.52$ 0.55$ 6.60$ Average Annual Cost Average Daily Cost Recommended Annual Charge City of Moses Lake Janitorial Supplies 200.00$ 0.55$ 6.58$ Conservative estimate; supplies are ordered as part of stock order and supplied to building weekly. City of Moses Lake Janitorial Service 1,140.00$ 3.12$ 37.48$ City staff clean operations building 1 times per week. City of Moses Lake Maintenance 130.00$ 0.36$ 4.27$ Estimated four hours of general maintenance annually; average cost considers staff time only, not cost of maintenance supplies. 1,270.00$ 3.48$ 48.33$ Grand Total 1,276.52$ 4.03$ 54.93$ *Average hourly cost based on 12 hours of operation daily. Source: 01-2022 to current utility history; Facilities Manager Service Totals Utility Totals Cost Analysis - Moses Lake Municipal Airport Operations Building COML Council Packet 11-14-23, Page 166 of 277 Page 2 of 2 Rate adjustments would need to be considered for increased frequency or duration of use. This rate does not include use of outside grounds or metered irrigation water. Should the Commission choose to move forward with a recommendation to City Council for adoption of this annual charge, the City Attorney will need to review your recommended lease and insurance requirements. There would be additional costs associated with the rental should city staff be asked to assist with scheduling use of, and providing access to, the building – that cost is not included in the suggested annual lease rate. COML Council Packet 11-14-23, Page 167 of 277 COML Council Packet 11-14-23, Page 168 of 277 COML Council Packet 11-14-23, Page 169 of 277 Council Staff Report To:Agenda Item Number: From Department For Agenda of:Proceeding Type Subject Reviewed and Approved by: Expenditure Required:Amount Budgeted:Appropriation Required: Action Requested Packet Attachments (if any) Kevin Fuhr, City Manager 13113 Brian Baltzell, Director Public Works 11/14/2023 Consent Agenda SR-17 and Yonezawa Round-a-bout Design Consultant City Manager City Attorney Community Development Finance Fire Human Resources Parks, Rec, & Cultural Services Police Public Works Technology Services 640,827.00$640,827.00$0.00$ Staff recommends that City Council motions to execute this consultant agreement between the City and Perteet Inc. Yonezawa Blvd RAB Agmt_Perteet_11-1-2023.pdf 2.38MB COML Council Packet 11-14-23, Page 170 of 277 Overview Fiscal and Policy Implications Approve, Authorize, or Adopt: Provide Amended Direction: No Action Taken: On June 8, 2023, the Engineering Division of the Public Works Department opened and reviewed submittals to our Request for Qualifications. The request was for engineering consultants interested in providing the City of Moses Lake with a preliminary design to construct a multi-lane roundabout at the intersection of State Route 17 and Yonezawa Blvd. Engineering consultant firms formally responded to their request. Each consultant summarized their experience relevant to the project state law requires the selection of engineering consultants must be conducted by qualifications first and fee negotiation second. Bidding for engineering consultation services is not allowed. A committee of four city staff members including two engineers studied the qualifications of each applicant and independently scored them using a common scoring system. The weighted average numerical scores were based on each applicant's relevant experience, project team member qualifications, references, and proposed project schedule. All four firms were invited to prepare a brief presentation and participate in an in-person interview on July 13, 2023. Each firm was again scored and rated by the committee of four city staff members. The committee then met to combine the scores into a composite score for each applicant and to discuss the results. The applicant with the highest score that was selected to move forward into the cost negotiation phase was petite incorporated. After thorough negotiations, Perteet Incorporated has since submitted a detailed scope of work and cost schedule that are acceptable to city staff. The public works department is in favor of moving forward with this agreement for the design of a Multilane roundabout at the intersection of SR17 and Yonezawa Ave. Prior to execution of final contract, the city will await final approval from WSDOT Local Programs staff who are acting as our certified agency for the grant funding paying for this project. This phase of the project is being funded through a Federal Surface Transportation Board Grant (STBG) awarded by Grant County. This Engineering design contract will be funded through a $760,000 STBG funds previously awarded to the city through Grant County Public Works. Options and Results City staff will execute a contract agreement with the selected consultant firm to develop plans for designing a multi lane roundabout at the intersection of SR17 and Yonezawa Ave. Staff will bring back options for recommended changes. City staff will await further instructions. COML Council Packet 11-14-23, Page 171 of 277 Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Agreement Number: Firm/Organization Legal Name (do not use dba’s): Address Federal Aid Number UBI Number Federal TIN or SSN Number Execution Date Completion Date 1099 Form Required Yes No Federal Participation Yes No Project Title Description of Work Yes No DBE Participation Yes No MBE Participation Yes No WBE Participation Yes No SBE Participation Total Amount Authorized: Management Reserve Fund: Maximum Amount Payable: Index of Exhibits Exhibit A Exhibit B Exhibit C Exhibit D Exhibit E Exhibit F Exhibit G Exhibit H Exhibit I Exhibit J Scope of Work DBE Participation Preparation and Delivery of Electronic Engineering and Other Data Prime Consultant Cost Computations Sub-consultant Cost Computations Title VI Assurances Certification Documents Liability Insurance Increase Alleged Consultant Design Error Procedures Consultant Claim Procedures Agreement Number: Page 1 of 14 Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 13% COML Council Packet 11-14-23, Page 172 of 277 THIS AGREEMENT, made and entered into as shown in the “Execution Date” box on page one (1) of this AGREEMENT, between the , hereinafter called the “AGENCY,” and the “Firm / Organization Name” referenced on page one (1) of this AGREEMENT, hereinafter called the “CONSULTANT.” WHEREAS, the AGENCY desires to accomplish the work referenced in “Description of Work” on page one (1) of this AGREEMENT and hereafter called the “SERVICES;” and does not have sufficient staff to meet the required commitment and therefore deems it advisable and desirable to engage the assistance of a CONSULTANT to provide the necessary SERVICES; and WHEREAS, the CONSULTANT represents that they comply with the Washington State Statutes relating to professional registration, if applicable, and has signified a willingness to furnish consulting services to the AGENCY. NOW, THEREFORE, in consideration of the terms, conditions, covenants, and performance contained herein, or attached and incorporated and made a part hereof, the parties hereto agree as follows: I.General Description of Work The work under this AGREEMENT shall consist of the above-described SERVICES as herein defined, and necessary to accomplish the completed work for this project. The CONSULTANT shall furnish all services, labor, and related equipment and, if applicable, sub-consultants and subcontractors necessary to conduct and complete the SERVICES as designated elsewhere in this AGREEMENT. II.General Scope of Work The Scope of Work and projected level of effort required for these SERVICES is described in Exhibit “A” attached hereto and by this reference made a part of this AGREEMENT. The General Scope of Work was developed utilizing performance based contracting methodologies. III.General Requirements All aspects of coordination of the work of this AGREEMENT with outside agencies, groups, or individuals shall receive advance approval by the AGENCY. Necessary contacts and meetings with agencies, groups, and/or individuals shall be coordinated through the AGENCY. The CONSULTANT shall attend coordination, progress, and presentation meetings with the AGENCY and/or such State, Federal, Community, City, or County officials, groups or individuals as may be requested by the AGENCY. The AGENCY will provide the CONSULTANT sufficient notice prior to meetings requiring CONSULTANT participation. The minimum required hours or days’ notice shall be agreed to between the AGENCY and the CONSULTANT and shown in Exhibit “A.” The CONSULTANT shall prepare a monthly progress report, in a form approved by the AGENCY, which will outline in written and graphical form the various phases and the order of performance of the SERVICES in sufficient detail so that the progress of the SERVICES can easily be evaluated. The CONSULTANT, any sub-consultants, and the AGENCY shall comply with all Federal, State, and local laws, rules, codes, regulations, and all AGENCY policies and directives, applicable to the work to be performed under this AGREEMENT. This AGREEMENT shall be interpreted and construed in accordance with the laws of the State of Washington. Agreement Number: Page 2 of 14 Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 COML Council Packet 11-14-23, Page 173 of 277 Participation for Disadvantaged Business Enterprises (DBE) or Small Business Enterprises (SBE), if required, per 49 CFR Part 26, shall be shown on the heading of this AGREEMENT. If DBE firms are utilized at the commencement of this AGREEMENT, the amounts authorized to each firm and their certification number will be shown on Exhibit “B” attached hereto and by this reference made part of this AGREEMENT. If the Prime CONSULTANT is a DBE certified firm they must comply with the Commercial Useful Function (CUF) regulation outlined in the AGENCY’s “DBE Program Participation Plan” and perform a minimum of 30% of the total amount of this AGREEMENT. It is recommended, but not required, that non-DBE Prime CONSULTANTS perform a minimum of 30% of the total amount of this AGREEMENT. In the absents of a mandatory DBE goal, a voluntary SBE goal amount of ten percent of the Consultant Agreement is established. The Consultant shall develop a SBE Participation Plan prior to commencing work. Although the goal is voluntary, the outreach efforts to provide SBE maximum practicable opportunities are not. The CONSULTANT, on a monthly basis, shall enter the amounts paid to all firms (including Prime) involved with this AGREEMENT into the wsdot.diversitycompliance.com program. Payment information shall identify any DBE Participation. All Reports, PS&E materials, and other data furnished to the CONSULTANT by the AGENCY shall be returned. All electronic files, prepared by the CONSULTANT, must meet the requirements as outlined in Exhibit “C – Preparation and Delivery of Electronic Engineering and other Data.” All designs, drawings, specifications, documents, and other work products, including all electronic files, prepared by the CONSULTANT prior to completion or termination of this AGREEMENT are instruments of service for these SERVICES, and are the property of the AGENCY. Reuse by the AGENCY or by others, acting through or on behalf of the AGENCY of any such instruments of service, not occurring as a part of this SERVICE, shall be without liability or legal exposure to the CONSULTANT. Any and all notices or requests required under this AGREEMENT shall be made in writing and sent to the other party by (i) certified mail, return receipt requested, or (ii) by email or facsimile, to the address set forth below: If to AGENCY: If to CONSULTANT: Name: Name: Agency: Agency: Address: Address: City: State: Zip: City: State: Zip: Email: Email: Phone: Phone: Facsimile: Facsimile: IV.Time for Beginning and Completion The CONSULTANT shall not begin any work under the terms of this AGREEMENT until authorized in writing by the AGENCY. All work under this AGREEMENT shall be completed by the date shown in the heading of this AGREEMENT titled “Completion Date.” The established completion time shall not be extended because of any delays attributable to the CONSULTANT, but may be extended by the AGENCY in the event of a delay attributable to the AGENCY, or because of unavoidable delays caused by an act of GOD, governmental actions, or other conditions beyond the control of the CONSULTANT. A prior supplemental AGREEMENT issued by the AGENCY is required to extend the established completion time. Agreement Number: Page 3 of 14 Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 COML Council Packet 11-14-23, Page 174 of 277 V.Payment Provisions The CONSULTANT shall be paid by the AGENCY for completed SERVICES rendered under this AGREEMENT as provided hereinafter. Such payment shall be full compensation for SERVICES performed or SERVICES rendered and for all labor, materials, supplies, equipment, and incidentals necessary to complete SERVICES, specified in Section II, “Scope of Work”. The CONSULTANT shall conform to all applicable portions of 48 CFR Part 31 (www.ecfr.gov). The estimate in support of the Cost Plus Fixed Fee amount is attached hereto as Exhibits “D” and “E” and by this reference made part of this AGREEMENT. A.Actual Costs: Payment for all consulting services for this PROJECT shall be on the basis of theCONSULTANT’S actual cost plus a fixed fee. The actual cost shall include direct salary cost, indirect cost rate,and direct non-salary costs. 1.Direct (RAW) Labor Costs: The Direct (RAW) Labor Cost is the direct salary paid to principals, professional, technical, and clerical personnel for the time they are productively engaged in work necessary to fulfill the terms of this AGREEMENT. The CONSULTANT shall maintain support data to verify the direct salary costs billed to the AGENCY. 2.Indirect Cost Rate (ICR) Costs: ICR Costs are those costs, other than direct costs, which are included as such on the books of the CONSULTANT in the normal everyday keeping of its books. Progress payments shall be made at the ICR rates shown in attached Exhibits “D” and “E” of this AGREEMENT. Total ICR payment shall be based on Actual Costs. The AGENCY agrees to reimburse the CONSULTANT the actual ICR costs verified by audit, up to the Maximum Total Amount Payable, authorized under this AGREEMENT, when accumulated with all other Actual Costs. A summary of the CONSULTANT’S cost estimate and the ICR percentage is shown in Exhibits “D” and “E”, attached hereto and by this reference made part of this AGREEMENT. The CONSULTANT (prime and all A&E sub-consultants) will submit to the AGENCY within six (6) months after the end of each firm’s fiscal year, an ICR schedule in the format required by the AGENCY (cost category, dollar expenditures, etc.) for the purpose of adjusting the ICR rate for billings received and paid during the fiscal year represented by the ICR schedule. It shall also be used for the computation of progress payments during the following year and for retroactively adjusting the previous year’s ICR cost to reflect the actual rate. The ICR schedule will be sent to Email: ConsultantRates@wsdot.wa.gov. Failure to supply this information by either the prime CONSULTANT or any of their A&E sub-consultants shall cause the AGENCY to withhold payment of the billed ICR costs until such time as the required information is received and an overhead rate for billing purposes is approved. The AGENCY’s Project Manager and/or the Federal Government may perform an audit of the CONSULTANT’S books and records at any time during regular business hours to determine the actual ICR rate, if they so desire. 3.Direct Non-Salary Costs: Direct Non-Salary Costs will be reimbursed at the Actual Cost to the CONSULTANT. (excluding Meals, which are reimbursed at the per diem rates identified in this section) These charges may include, but are not limited to, the following items: travel, printing, long distance telephone, supplies, computer charges and fees of sub-consultants. Air or train travel will be reimbursed only to economy class levels unless otherwise approved by the AGENCY. The CONSULTANT shall comply with the rules and regulations regarding travel costs (excluding air, train, and rental car costs) in accordance with WSDOT’s Accounting Manual M 13-82, Chapter 10 – Travel Rules and Procedures, and revisions thereto. Air, train, and rental car costs shall be reimbursed in accordance with 48 Code of Federal Regulations (CFR) Part 31.205-46 “Travel Costs.” The billing for Direct Non-Salary Costs shall include an itemized listing of the charges directly identifiable with the PROJECT. The CONSULTANT shall maintain the original supporting documents in their office. Copies of the original supporting documents shall be supplied to the AGENCY upon request. All above charges must be necessary for the services provided under this AGREEMENT.Agreement Number: Page 4 of 14 Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 COML Council Packet 11-14-23, Page 175 of 277 4.Fixed Fee: The Fixed Fee, which represents the CONSULTANT’S profit, is shown in attached Exhibits “D”and “E” of this AGREEMENT. This fee is based on the Scope of Work defined in this AGREEMENT andthe estimated person-hours required to perform the stated Scope of Work. In the event the CONSULTANTenters into a supplemental AGREEMENT for additional work, the supplemental AGREEMENT mayinclude provisions for the added costs and an appropriate additional fee. The Fixed Fee will be proratedand paid monthly in proportion to the percentage of work completed by the CONSULTANT and reportedin the Monthly Progress Reports accompanying the billings. Any portion of the Fixed Fee earned but notpreviously paid in the progress payments will be covered in the final payment, subject to the provisions ofSection IX entitled “Termination of Agreement.” 5.Management Reserve Fund (MRF): The AGENCY may desire to establish MRF to provide the AgreementAdministrator with the flexibility to authorize additional funds to the AGREEMENT for allowableunforeseen costs, or reimbursing the CONSULTANT for additional work beyond that already defined inthis AGREEMENT. Such authorization(s) shall be in writing and shall not exceed the lesser of $100,000 or10% of the Total Amount Authorized as shown in the heading of this AGREEMENT. The amount includedfor the MRF is shown in the heading of this AGREEMENT. This fund may not be replenished. Anychanges requiring additional costs in excess of the MRF shall be made in accordance with Section XIII,“Extra Work.” 6.Maximum Total Amount Payable: The Maximum Total Amount Payable by the AGENCY to theCONSULTANT under this AGREEMENT shall not exceed the amount shown in the heading of thisAGREEMENT. The Maximum Total Amount Payable is comprised of the Total Amount Authorized, andthe MRF. The Maximum Total Amount Payable does not include payment for Extra Work as stipulated inSection XIII, “Extra Work.” No minimum amount payable is guaranteed under this AGREEMENT. B. Monthly Progress Payments: The CONSULTANT may submit billings to the AGENCY for reimbursement ofActual Costs plus the ICR and calculated fee on a monthly basis during the progress of the work. Such billingsshall be in a format approved by the AGENCY and accompanied by the monthly progress reports required underSection III, “General Requirements” of this AGREEMENT. The billings will be supported by an itemizedlisting for each item including Direct (RAW) Labor, Direct Non-Salary, and allowable ICR Costs to which willbe added the prorated Fixed Fee. To provide a means of verifying the billed Direct (RAW) Labor costs forCONSULTANT employees, the AGENCY may conduct employee interviews. These interviews may consist ofrecording the names, titles, Direct (RAW) Labor rates, and present duties of those employees performing workon the PROJECT at the time of the interview. C.Final Payment: Final Payment of any balance due the CONSULTANT of the gross amount earned will be madepromptly upon its verification by the AGENCY after the completion of the work under this AGREEMENT,contingent, if applicable, upon receipt of all PS&E, plans, maps, notes, reports, electronic data and other relateddocuments which are required to be furnished under this AGREEMENT. Acceptance of such Final Payment bythe CONSULTANT shall constitute a release of all claims for payment, which the CONSULTANT may haveagainst the AGENCY unless such claims are specifically reserved in writing and transmitted to the AGENCY bythe CONSULTANT prior to its acceptance. Said Final Payment shall not, however, be a bar to any claims thatthe AGENCY may have against the CONSULTANT or to any remedies the AGENCY may pursue with respectto such claims. The payment of any billing will not constitute agreement as to the appropriateness of any item and at the time of final audit; all required adjustments will be made and reflected in a final payment. In the event that such final audit reveals an overpayment to the CONSULTANT, the CONSULTANT will refund such overpayment to the AGENCY within thirty (30) calendar days of notice of the overpayment. Such refund shall not constitute a waiver by the CONSULTANT for any claims relating to the validity of a finding by the AGENCY of overpayment. The CONSULTANT has twenty (20) working days after receipt of the final POST AUDIT to begin the appeal process to the AGENCY for audit findings. Agreement Number: Page 5 of 14 Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 COML Council Packet 11-14-23, Page 176 of 277          D.Inspection of Cost Records: The CONSULTANT and their sub-consultants shall keep available for inspectionby representatives of the AGENCY and the United States, for a period of six (6) years after receipt of finalpayment, the cost records and accounts pertaining to this AGREEMENT and all items related to or bearing uponthese records with the following exception: if any litigation, claim or audit arising out of, in connection with,or related to this AGREEMENT is initiated before the expiration of the six (6) year period, the cost records andaccounts shall be retained until such litigation, claim, or audit involving the records is completed. An interim or post audit may be performed on this AGREEMENT. The audit, if any, will be performed by theState Auditor, WSDOT’s Internal Audit Office and/or at the request of the AGENCY’s Project Manager. VI.Sub-Contracting The AGENCY permits subcontracts for those items of SERVICES as shown in Exhibit “A” attached hereto and by this reference made part of this AGREEMENT. The CONSULTANT shall not subcontract for the performance of any SERVICE under this AGREEMENT without prior written permission of the AGENCY. No permission for subcontracting shall create, between the AGENCY and sub-consultant, any contract or any other relationship. Compensation for this sub-consultant SERVICES shall be based on the cost factors shown on Exhibit “E” attached hereto and by this reference made part of this AGREEMENT. The SERVICES of the sub-consultant shall not exceed its maximum amount payable identified in each sub-consultant cost estimate unless a prior written approval has been issued by the AGENCY. All reimbursable direct labor, indirect cost rate, direct non-salary costs and fixed fee costs for the sub-consultant shall be negotiated and substantiated in accordance with section V “Payment Provisions” herein and shall be memorialized in a final written acknowledgement between the parties. All subcontracts shall contain all applicable provisions of this AGREEMENT, and the CONSULTANT shall require each sub-consultant or subcontractor, of any tier, to abide by the terms and conditions of this AGREEMENT. With respect to sub-consultant payment, the CONSULTANT shall comply with all applicable sections of the STATE’s Prompt Payment laws as set forth in RCW 39.04.250 and RCW 39.76.011. The CONSULTANT, sub-recipient, or sub-consultant shall not discriminate on the basis of race, color, national origin, or sex in the performance of this AGREEMENT. The CONSULTANT shall carry out applicable requirements of 49 CFR Part 26 in the award and administration of DOT-assisted contracts. Failure by the CONSULTANT to carry out these requirements is a material breach of this AGREEMENT, which may result in the termination of this AGREEMENT or such other remedy as the recipient deems appropriate. VII.Employment and Organizational Conflict of Interest The CONSULTANT warrants that they have not employed or retained any company or person, other than a bona fide employee working solely for the CONSULTANT, to solicit or secure this contract, and that it has not paid or agreed to pay any company or person, other than a bona fide employee working solely for the CONSULTANT, any fee, commission, percentage, brokerage fee, gift, or any other consideration, contingent upon or resulting from the award or making of this contract. For breach or violation of this warrant, the AGENCY shall have the right to annul this AGREEMENT without liability or, in its discretion, to deduct from this AGREEMENT price or consideration or otherwise recover the full amount of such fee, commission, percentage, brokerage fee, gift, or contingent fee. Any and all employees of the CONSULTANT or other persons while engaged in the performance of any work or services required of the CONSULTANT under this AGREEMENT, shall be considered employees of the CONSULTANT only and not of the AGENCY, and any and all claims that may arise under any Workmen’s Agreement Number: Page 6 of 14 Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 COML Council Packet 11-14-23, Page 177 of 277 Compensation Act on behalf of said employees or other persons while so engaged, and any and all claims made by a third party as a consequence of any act or omission on the part of the CONSULTANT’s employees or other persons while so engaged on any of the work or services provided to be rendered herein, shall be the sole obligation and responsibility of the CONSULTANT. The CONSULTANT shall not engage, on a full- or part-time basis, or other basis, during the period of this AGREEMENT, any professional or technical personnel who are, or have been, at any time during the period of this AGREEMENT, in the employ of the United States Department of Transportation or the AGENCY, except regularly retired employees, without written consent of the public employer of such person if he/she will be working on this AGREEMENT for the CONSULTANT. VIII.Nondiscrimination During the performance of this AGREEMENT, the CONSULTANT, for itself, its assignees, sub-consultants, subcontractors and successors in interest, agrees to comply with the following laws and regulations:  Title VI of the Civil Rights Act of 1964 • Civil Rights Restoration Act of 1987(42 U.S.C. Chapter 21 Subchapter V § 2000d (Public Law 100-259)through 2000d-4a) • American with Disabilities Act of 1990•Federal-aid Highway Act of 1973 (42 U.S.C. Chapter 126 § 12101 et. seq.)(23 U.S.C. Chapter 3 § 324)• 23 CFR Part 200•Rehabilitation Act of 1973  49 CFR Part 21(29 U.S.C. Chapter 16 Subchapter V § 794) 49 CFR Part 26•Age Discrimination Act of 1975 •RCW 49.60.180(42 U.S.C. Chapter 76 § 6101 et. seq.) In relation to Title VI of the Civil Rights Act of 1964, the CONSULTANT is bound by the provisions of Exhibit “F” attached hereto and by this reference made part of this AGREEMENT, and shall include the attached Exhibit “F” in every sub-contract, including procurement of materials and leases of equipment, unless exempt by the Regulations or directives issued pursuant thereto. IX.Termination of Agreement The right is reserved by the AGENCY to terminate this AGREEMENT at any time with or without cause upon ten (10)days written notice to the CONSULTANT. In the event this AGREEMENT is terminated by the AGENCY, other than for default on the part of the CONSULTANT, a final payment shall be made to the CONSULTANT for actual hours charged and any appropriate fixed fee percentage at the time of termination of this AGREEMENT, plus any direct non-salary costs incurred up to the time of termination of this AGREEMENT. No payment shall be made for any SERVICES completed after ten (10) days following receipt by the CONSULTANT of the notice to terminate. If the accumulated payment made to the CONSULTANT prior to Notice of Termination exceeds the total amount that would be due when computed as set forth in paragraph two (2) of this section, then no final payment shall be due and the CONSULTANT shall immediately reimburse the AGENCY for any excess paid. If the services of the CONSULTANT are terminated by the AGENCY for default on the part of the CONSULTANT, the above formula for payment shall not apply. In the event of a termination for default, the amount to be paid to the CONSULTANT shall be determined by the AGENCY with consideration given to the actual costs incurred by the CONSULTANT in performing SERVICES to the date of termination, the amount of SERVICES originally required which was satisfactorily completed to Agreement Number: Page 7 of 14 Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 COML Council Packet 11-14-23, Page 178 of 277 date of termination, whether that SERVICE is in a form or a type which is usable to the AGENCY at the time of termination, the cost to the AGENCY of employing another firm to complete the SERVICES required and the time which may be required to do so, and other factors which affect the value to the AGENCY of the SERVICES performed at the time of termination. Under no circumstances shall payment made under this subsection exceed the amount, which would have been made using the formula set forth in paragraph two (2) of this section. If it is determined for any reason that the CONSULTANT was not in default or that the CONSULTANT’s failure to perform is without the CONSULTANT’s or its employee’s fault or negligence, the termination shall be deemed to be a termination for the convenience of the AGENCY. In such an event, the CONSULTANT would be reimbursed for actual costs and appropriate fixed fee percentage in accordance with the termination for other than default clauses listed previously. The CONSULTANT shall, within 15 days, notify the AGENCY in writing, in the event of the death of any member, partner, or officer of the CONSULTANT or the death or change of any of the CONSULTANT’s supervisory and/or other key personnel assigned to the project or disaffiliation of any principally involved CONSULTANT employee. The CONSULTANT shall also notify the AGENCY, in writing, in the event of the sale or transfer of 50% or more of the beneficial ownership of the CONSULTANT within 15 days of such sale or transfer occurring. The CONSULTANT shall continue to be obligated to complete the SERVICES under the terms of this AGREEMENT unless the AGENCY chooses to terminate this AGREEMENT for convenience or chooses to renegotiate any term(s) of this AGREEMENT. If termination for convenience occurs, final payment will be made to the CONSULTANT as set forth in the second and third paragraphs of this section. Payment for any part of the SERVICES by the AGENCY shall not constitute a waiver by the AGENCY of any remedies of any type it may have against the CONSULTANT for any breach of this AGREEMENT by the CONSULTANT, or for failure of the CONSULTANT to perform SERVICES required of it by the AGENCY. Forbearance of any rights under the AGREEMENT will not constitute waiver of entitlement to exercise those rights with respect to any future act or omission by the CONSULTANT. X.Changes of Work The CONSULTANT shall make such changes and revisions in the completed work of this AGREEMENT as necessary to correct errors appearing therein, without additional compensation thereof. Should the AGENCY find it desirable for its own purposes to have previously satisfactorily completed SERVICES or parts thereof changed or revised, the CONSULTANT shall make such revisions as directed by the AGENCY. This work shall be considered as Extra Work and will be paid for as herein provided under section XIII “Extra Work.” XI.Disputes Any disputed issue not resolved pursuant to the terms of this AGREEMENT shall be submitted in writing within 10 days to the Director of Public Works or AGENCY Engineer, whose decision in the matter shall be final and binding on the parties of this AGREEMENT; provided however, that if an action is brought challenging the Director of Public Works or AGENCY Engineer’s decision, that decision shall be subject to judicial review. If the parties to this AGREEMENT mutually agree, disputes concerning alleged design errors will be conducted under the procedures found in Exhibit “J”. In the event that either party deem it necessary to institute legal action or proceeding to enforce any right or obligation under this AGREEMENT, this action shall be initiated in the Superior Court of the State of Washington, situated in the county in which the AGENCY is located. The parties hereto agree that all questions shall be resolved by application of Washington law and that the parties have the right of appeal from such decisions of the Superior Court in accordance with the laws of the State of Washington. The CONSULTANT hereby consents to the personal jurisdiction of the Superior Court of the State of Washington, situated in the county in which the AGENCY is located. Agreement Number: Page 8 of 14 Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 COML Council Packet 11-14-23, Page 179 of 277 XII.Legal Relations The CONSULTANT, any sub-consultants, and the AGENCY shall comply with all Federal, State, and local laws, rules, codes, regulations and all AGENCY policies and directives, applicable to the work to be performed under this AGREEMENT. This AGREEMENT shall be interpreted and construed in accordance with the laws of the State of Washington. The CONSULTANT shall defend, indemnify, and hold The State of Washington (STATE) and the AGENCY and their officers and employees harmless from all claims, demands, or suits at law or equity arising in whole or in part from the negligence of, or the breach of any obligation under this AGREEMENT by, the CONSULTANT or the CONSULTANT’s agents, employees, sub consultants, subcontractors or vendors, of any tier, or any other persons for whom the CONSULTANT may be legally liable; provided that nothing herein shall require a CONSULTANT to defend or indemnify the STATE and the AGENCY and their officers and employees against and hold harmless the STATE and the AGENCY and their officers and employees from claims, demands or suits based solely upon the negligence of, or breach of any obligation under this AGREEMENT by the STATE and the AGENCY, their agents, officers, employees, sub-consultants, subcontractors or vendors, of any tier, or any other persons for whom the STATE and/or the AGENCY may be legally liable; and provided further that if the claims or suits are caused by or result from the concurrent negligence of (a) the CONSULTANT or the CONSULTANT’s agents, employees, sub-consultants, subcontractors or vendors, of any tier, or any other persons for whom the CONSULTANT is legally liable, and (b) the STATE and/or AGENCY, their agents, officers, employees, sub-consultants, subcontractors and or vendors, of any tier, or any other persons for whom the STATE and or AGENCY may be legally liable, the defense and indemnity obligation shall be valid and enforceable only to the extent of the CONSULTANT’s negligence or the negligence of the CONSULTANT’s agents, employees, sub-consultants, subcontractors or vendors, of any tier, or any other persons for whom the CONSULTANT may be legally liable. This provision shall be included in any AGREEMENT between CONSULTANT and any sub-consultant, subcontractor and vendor, of any tier. The CONSULTANT shall also defend, indemnify, and hold the STATE and the AGENCY and their officers and employees harmless from all claims, demands, or suits at law or equity arising in whole or in part from the alleged patent or copyright infringement or other allegedly improper appropriation or use of trade secrets, patents, proprietary information, know-how, copyright rights or inventions by the CONSULTANT or the CONSULTANT’s agents, employees, sub-consultants, subcontractors or vendors, of any tier, or any other persons for whom the CONSULTANT may be legally liable, in performance of the Work under this AGREEMENT or arising out of any use in connection with the AGREEMENT of methods, processes, designs, information or other items furnished or communicated to STATE and/or the AGENCY, their agents, officers and employees pursuant to the AGREEMENT; provided that this indemnity shall not apply to any alleged patent or copyright infringement or other allegedly improper appropriation or use of trade secrets, patents, proprietary information, know-how, copyright rights or inventions resulting from STATE and/or AGENCY’s, their agents’, officers’ and employees’ failure to comply with specific written instructions regarding use provided to STATE and/or AGENCY, their agents, officers and employees by the CONSULTANT, its agents, employees, sub-consultants, subcontractors or vendors, of any tier, or any other persons for whom the CONSULTANT may be legally liable. The CONSULTANT’s relation to the AGENCY shall be at all times as an independent contractor. Notwithstanding any determination by the Executive Ethics Board or other tribunal, the AGENCY may, in its sole discretion, by written notice to the CONSULTANT terminate this AGREEMENT if it is found after due notice and examination by the AGENCY that there is a violation of the Ethics in Public Service Act, Chapter 42.52 RCW; or any similar statute involving the CONSULTANT in the procurement of, or performance under, this AGREEMENT. The CONSULTANT specifically assumes potential liability for actions brought by the CONSULTANT’s own employees or its agents against the STATE and /or the AGENCY and, solely for the purpose of this indemnification and defense, the CONSULTANT specifically waives any immunity under the state industrial insurance law, Title 51 RCW. This waiver has been mutually negotiated between the Parties. Agreement Number: Page 9 of 14 Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 COML Council Packet 11-14-23, Page 180 of 277 Unless otherwise specified in this AGREEMENT, the AGENCY shall be responsible for administration of construction contracts, if any, on the project. Subject to the processing of a new sole source, or an acceptable supplemental AGREEMENT, the CONSULTANT shall provide On-Call assistance to the AGENCY during contract administration. By providing such assistance, the CONSULTANT shall assume no responsibility for: proper construction techniques, job site safety, or any construction contractor’s failure to perform its work in accordance with the contract documents. The CONSULTANT shall obtain and keep in force during the terms of this AGREEMENT, or as otherwise required, the following insurance with companies or through sources approved by the State Insurance Commissioner pursuant to Title 48 RCW. Insurance Coverage A.Worker’s compensation and employer’s liability insurance as required by the STATE. B.Commercial general liability insurance written under ISO Form CG 00 01 12 04 or its equivalent with minimumlimits of one million dollars ($1,000,000.00) per occurrence and two million dollars ($2,000,000.00) in theaggregate for each policy period. C.Business auto liability insurance written under ISO Form CG 00 01 10 01 or equivalent providing coverage forany “Auto” (Symbol 1) used in an amount not less than a one million dollar ($1,000,000.00) combined singlelimit for each occurrence. Excepting the Worker’s Compensation Insurance and any Professional Liability Insurance, the STATE and AGENCY, their officers, employees, and agents will be named on all policies of CONSULTANT and any sub-consultant and/or subcontractor as an additional insured (the “AIs”), with no restrictions or limitations concerning products and completed operations coverage. This coverage shall be primary coverage and non-contributory and any coverage maintained by the AIs shall be excess over, and shall not contribute with, the additional insured coverage required hereunder. The CONSULTANT’s and the sub-consultant’s and/or subcontractor’s insurer shall waive any and all rights of subrogation against the AIs. The CONSULTANT shall furnish the AGENCY with verification of insurance and endorsements required by this AGREEMENT. The AGENCY reserves the right to require complete, certified copies of all required insurance policies at any time. All insurance shall be obtained from an insurance company authorized to do business in the State of Washington. The CONSULTANT shall submit a verification of insurance as outlined above within fourteen (14) days of the execution of this AGREEMENT to: Name: Agency: Address: City: State: Zip: Email: Phone: Facsimile: No cancellation of the foregoing policies shall be effective without thirty (30) days prior notice to the AGENCY. The CONSULTANT’s professional liability to the AGENCY, including that which may arise in reference to section IX “Termination of Agreement” of this AGREEMENT, shall be limited to the accumulative amount of the authorized AGREEMENT amount or one million dollars ($1,000,000.00), whichever is greater, unless the limit of liability is increased by the AGENCY pursuant to Exhibit H. In no case shall the CONSULTANT’s professional liability to third parties be limited in any way. Agreement Number: Page 10 of 14 Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 COML Council Packet 11-14-23, Page 181 of 277            The parties enter into this AGREEMENT for the sole benefit of the parties, and to the exclusion of any third party, and no third party beneficiary is intended or created by the execution of this AGREEMENT. The AGENCY will pay no progress payments under section V “Payment Provisions” until the CONSULTANT has fully complied with this section. This remedy is not exclusive; and the AGENCY may take such other action as is available to it under other provisions of this AGREEMENT, or otherwise in law. XIII.Extra Work A.The AGENCY may at any time, by written order, make changes within the general scope of this AGREEMENTin the SERVICES to be performed. B.If any such change causes an increase or decrease in the estimated cost of, or the time required for, performanceof any part of the SERVICES under this AGREEMENT, whether or not changed by the order, or otherwiseaffects any other terms and conditions of this AGREEMENT, the AGENCY shall make an equitable adjustmentin the: (1) maximum amount payable; (2) delivery or completion schedule, or both; and (3) other affected termsand shall modify this AGREEMENT accordingly. C.The CONSULTANT must submit any “request for equitable adjustment,” hereafter referred to as “CLAIM,”under this clause within thirty (30) days from the date of receipt of the written order. However, if the AGENCYdecides that the facts justify it, the AGENCY may receive and act upon a CLAIM submitted before finalpayment of this AGREEMENT. D.Failure to agree to any adjustment shall be a dispute under the section XI “Disputes” clause. However, nothingin this clause shall excuse the CONSULTANT from proceeding with the AGREEMENT as changed. E.Notwithstanding the terms and conditions of paragraphs (A.) and (B.) above, the maximum amount payable forthis AGREEMENT, shall not be increased or considered to be increased except by specific written supplementto this AGREEMENT. XIV.Endorsement of Plans If applicable, the CONSULTANT shall place their endorsement on all plans, estimates, or any other engineering data furnished by them. XV.Federal Review The Federal Highway Administration shall have the right to participate in the review or examination of the SERVICES in progress. XVI.Certification of the Consultant and the Agency Attached hereto as Exhibit “G-1(a and b)” are the Certifications of the CONSULTANT and the AGENCY, Exhibit “G-2” Certification Regarding Debarment, Suspension and Other Responsibility Matters - Primary Covered Transactions, Exhibit “G-3” Certification Regarding the Restrictions of the Use of Federal Funds for Lobbying and Exhibit “G-4” Certificate of Current Cost or Pricing Data. Exhibit “G-3” is required only in AGREEMENT’s over one hundred thousand dollars ($100,000.00) and Exhibit “G-4” is required only in AGREEMENT’s over five hundred thousand dollars ($500,000.00.) These Exhibits must be executed by the CONSULTANT, and submitted with the master AGREEMENT, and returned to the AGENCY at the address listed in section III “General Requirements” prior to its performance of any SERVICES under this AGREEMENT. Agreement Number: Page 11 of 14 Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 COML Council Packet 11-14-23, Page 182 of 277      XVII.Complete Agreement This document and referenced attachments contain all covenants, stipulations, and provisions agreed upon by the parties. No agent, or representative of either party has authority to make, and the parties shall not be bound by or be liable for, any statement, representation, promise or agreement not set forth herein. No changes, amendments, or modifications of the terms hereof shall be valid unless reduced to writing and signed by the parties as a supplement to this AGREEMENT. XVIII.Execution and Acceptance This AGREEMENT may be simultaneously executed in several counterparts, each of which shall be deemed to be an original having identical legal effect. The CONSULTANT does hereby ratify and adopt all statements, representations, warranties, covenants, and AGREEMENT’s contained in the proposal, and the supporting material submitted by the CONSULTANT, and does hereby accept this AGREEMENT and agrees to all of the terms and conditions thereof. XIX.Protection of Confidential Information The CONSULTANT acknowledges that some of the material and information that may come into its possession or knowledge in connection with this AGREEMENT or its performance may consist of information that is exempt from disclosure to the public or other unauthorized persons under either chapter 42.56 RCW or other local, state or federal statutes (“State’s Confidential Information”). The “State’s Confidential Information” includes, but is not limited to, names, addresses, Social Security numbers, e-mail addresses, telephone numbers, financial profiles, credit card information, driver’s license numbers, medical data, law enforcement records (or any other information identifiable to an individual), STATE and AGENCY source code or object code, STATE and AGENCY security data, non-public Specifications, STATE and AGENCY non-publicly available data, proprietary software, State security data, or information which may jeopardize any part of the project that relates to any of these types of information. The CONSULTANT agrees to hold the State’s Confidential Information in strictest confidence and not to make use of the State’s Confidential Information for any purpose other than the performance of this AGREEMENT, to release it only to authorized employees, sub-consultants or subcontractors requiring such information for the purposes of carrying out this AGREEMENT, and not to release, divulge, publish, transfer, sell, disclose, or otherwise make it known to any other party without the AGENCY’s express written consent or as provided by law. The CONSULTANT agrees to release such information or material only to employees, sub-consultants or subcontractors who have signed a nondisclosure AGREEMENT, the terms of which have been previously approved by the AGENCY. The CONSULTANT agrees to implement physical, electronic, and managerial safeguards to prevent unauthorized access to the State’s Confidential Information. Immediately upon expiration or termination of this AGREEMENT, the CONSULTANT shall, at the AGENCY’s option: (i) certify to the AGENCY that the CONSULTANT has destroyed all of the State’s Confidential Information; or (ii) returned all of the State’s Confidential Information to the AGENCY; or (iii) take whatever other steps the AGENCY requires of the CONSULTANT to protect the State’s Confidential Information. As required under Executive Order 00-03, the CONSULTANT shall maintain a log documenting the following: the State’s Confidential Information received in the performance of this AGREEMENT; the purpose(s) for which the State’s Confidential Information was received; who received, maintained and used the State’s Confidential Information; and the final disposition of the State’s Confidential Information. The CONSULTANT’s records shall be subject to inspection, review, or audit upon reasonable notice from the AGENCY. The AGENCY reserves the right to monitor, audit, or investigate the use of the State’s Confidential Information collected, used, or acquired by the CONSULTANT through this AGREEMENT. The monitoring, auditing, or investigating may include, but is not limited to, salting databases. Agreement Number: Page 12 of 14 Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 COML Council Packet 11-14-23, Page 183 of 277 Violation of this section by the CONSULTANT or its sub-consultants or subcontractors may result in termination of this AGREEMENT and demand for return of all State’s Confidential Information, monetary damages, or penalties. It is understood and acknowledged that the CONSULTANT may provide the AGENCY with information which is proprietary and/or confidential during the term of this AGREEMENT. The parties agree to maintain the confidentiality of such information during the term of this AGREEMENT and afterwards. All materials containing such proprietary and/or confidential information shall be clearly identified and marked as “Confidential” and shall be returned to the disclosing party at the conclusion of the SERVICES under this AGREEMENT. The CONSULTANT shall provide the AGENCY with a list of all information and materials it considers confidential and/or proprietary in nature: (a) at the commencement of the term of this AGREEMENT; or (b) as soon as such confidential or proprietary material is developed. “Proprietary and/or confidential information” is not meant to include any information which, at the time of its disclosure: (i) is already known to the other party; (ii) is rightfully disclosed to one of the parties by a third party that is not acting as an agent or representative for the other party; (iii)is independently developed by or for the other party; (iv) is publicly known; or (v) is generally utilized byunaffiliated third parties engaged in the same business or businesses as the CONSULTANT. The parties also acknowledge that the AGENCY is subject to Washington State and federal public disclosure laws. As such, the AGENCY shall maintain the confidentiality of all such information marked proprietary and/ or confidential or otherwise exempt, unless such disclosure is required under applicable state or federal law. If a public disclosure request is made to view materials identified as “Proprietary and/or confidential information” or otherwise exempt information, the AGENCY will notify the CONSULTANT of the request and of the date that such records will be released to the requester unless the CONSULTANT obtains a court order from a court of competent jurisdiction enjoining that disclosure. If the CONSULTANT fails to obtain the court order enjoining disclosure, the AGENCY will release the requested information on the date specified. The CONSULTANT agrees to notify the sub-consultant of any AGENCY communication regarding disclosure that may include a sub-consultant’s proprietary and/or confidential information. The CONSULTANT notification to the sub-consultant will include the date that such records will be released by the AGENCY to the requester and state that unless the sub-consultant obtains a court order from a court of competent jurisdiction enjoining that disclosure the AGENCY will release the requested information. If the CONSULTANT and/or sub-consultant fail to obtain a court order or other judicial relief enjoining the AGENCY by the release date, the CONSULTANT shall waive and release and shall hold harmless and indemnify the AGENCY from all claims of actual or alleged damages, liabilities, or costs associated with the AGENCY’s said disclosure of sub-consultants’ information. XX.Records Maintenance During the progress of the Work and SERVICES provided hereunder and for a period of not less than six (6) years from the date of final payment to the CONSULTANT, the CONSULTANT shall keep, retain and maintain all “documents” pertaining to the SERVICES provided pursuant to this AGREEMENT. Copies of all “documents” pertaining to the SERVICES provided hereunder shall be made available for review at the CONSULTANT’s place of business during normal working hours. If any litigation, claim or audit is commenced, the CONSULTANT shall cooperate with AGENCY and assist in the production of all such documents. “Documents” shall be retained until all litigation, claims or audit findings have been resolved even though such litigation, claim or audit continues past the six (6) year retention period. For purposes of this AGREEMENT, “documents” means every writing or record of every type and description, including electronically stored information (“ESI”), that is in the possession, control, or custody of the CONSULTANT, including, without limitation, any and all correspondences, contracts, AGREEMENT ‘s, appraisals, plans, designs, data, surveys, maps, spreadsheets, memoranda, stenographic or handwritten notes, reports, records, telegrams, schedules, diaries, notebooks, logbooks, invoices, accounting records, work sheets, charts, notes, drafts, scribblings, recordings, visual displays, photographs, minutes of meetings, Agreement Number: Page 13 of 14 Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 COML Council Packet 11-14-23, Page 184 of 277 tabulations, computations, summaries, inventories, and writings regarding conferences, conversations or telephone conversations, and any and all other taped, recorded, written, printed or typed matters of any kind or description; every copy of the foregoing whether or not the original is in the possession, custody, or control of the CONSULTANT, and every copy of any of the foregoing, whether or not such copy is a copy identical to an original, or whether or not such copy contains any commentary or notation whatsoever that does not appear on the original. For purposes of this AGREEMENT, “ESI” means any and all computer data or electronic recorded media of any kind, including “Native Files”, that are stored in any medium from which it can be retrieved and examined, either directly or after translation into a reasonably useable form. ESI may include information and/or documentation stored in various software programs such as: Email, Outlook, Word, Excel, Access, Publisher, PowerPoint, Adobe Acrobat, SQL databases, or any other software or electronic communication programs or databases that the CONSULTANT may use in the performance of its operations. ESI may be located on network servers, backup tapes, smart phones, thumb drives, CDs, DVDs, floppy disks, work computers, cell phones, laptops or any other electronic device that CONSULTANT uses in the performance of its Work or SERVICES hereunder, including any personal devices used by the CONSULTANT or any sub-consultant at home. “Native files” are a subset of ESI and refer to the electronic format of the application in which such ESI is normally created, viewed, and /or modified. The CONSULTANT shall include this section XX “Records Maintenance” in every subcontract it enters into in relation to this AGREEMENT and bind the sub-consultant to its terms, unless expressly agreed to otherwise in writing by the AGENCY prior to the execution of such subcontract. In witness whereof, the parties hereto have executed this AGREEMENT as of the day and year shown in the “Execution Date” box on page one (1) of this AGREEMENT. Signature Date Signature Date Any modification, change, or reformation of this AGREEMENT shall require approval as to form by the Office of the Attorney General. Agreement Number: Page 14 of 14 Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 COML Council Packet 11-14-23, Page 185 of 277 Exhibit A Scope of Work Project No. Agreement Number: Exhibit A - Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 Page 1 of 1 COML Council Packet 11-14-23, Page 186 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 1 EXHIBIT A SCOPE OF SERVICES City of Moses Lake SR 17/Yonezawa Boulevard Intersection Improvements INTRODUCTION The overall objective of this phase of the Yonezawa Boulevard project is to prepare a bid package for the construction of a new roundabout at the intersection of SR 17 and Yonezawa Boulevard, including a new east leg of the intersection. This work includes coordination by Perteet Inc. (Consultant) and the City of Moses Lake (City) with Washington State Department of Transportation (WSDOT) to gain necessary approvals for construction on the state highway and with the federal funds involved in the project. This work also includes topographic survey, geotechnical analysis, and right-of-way elements to facilitate the design and construction of the new roundabout. Consultant’s services will be limited to those expressly set forth herein. If the service is not specifically identified herein, it is expressly excluded. Consultant will have no other obligations, duties, or responsibilities associated with the project except as expressly provided in this Agreement. Transferring Budget within Contract Maximum: The level of effort is specified in the scope of services. The budget may be transferred between discipline tasks at the discretion of the Consultant, provided that the total contracted amount is not exceeded. The Consultant will have the flexibility to manage budget within a given discipline on a subtask level. Services provided by the Consultant will consist of: GENERAL SCOPE OF SERVICES This Scope of Services describes the work elements to be accomplished by the Consultant and its subconsultants as summarized under each task. This scope consists of the following elements: Task 1 – Project Management Task 2 – Coordination Meetings Task 3 – WSDOT Documentation Task 4 – Utility Coordination Task 5 – Right-of-Way Program Task 6 – Topographic Survey and Basemapping Task 7 – Geotechnical Investigations Task 8 – Public Outreach Program Task 9 – Environmental Documentation and Permitting Task 10 – Storm Drainage Design Task 11 – Landscaping, Irrigation, and Urban Design Task 12 – 30% Design Task 13 – 60% Design Task 14 – 90% Design COML Council Packet 11-14-23, Page 187 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 2 Task 15 – Ad-Ready Design Task 16 – Bid Support Optional Services With prior written approval by the City and written notice-to-proceed, work elements described in this scope of services as optional services (as directed) may be produced by the Consultant. This Scope of Services is defined in the tasks below. Unless otherwise noted, all deliverables will be submitted electronically and in PDF format. SCOPE OF SERVICES DEFINED Task 1 – Project Management Continuous Project Management The Consultant will provide continuous project management administration (billing invoices, monthly progress reports, Consultant coordination) throughout the project’s duration (assume 18 months). In the event that the City has a change in the City’s project manager, the Consultant will meet with the new project manager, provide a summary of design and progress, provide a summary of decisions made, and provide past deliverables to date. This effort is included in this task. If changes to completed design efforts and/or Scope of Services are requested due to the change in City’s project manager, this will require a supplement to the Agreement. Budget and Schedule Oversight The Consultant will monitor project budget and schedule. Schedule will be developed using Microsoft Project. The Consultant will prepare a baseline project schedule and will update that schedule with actual completion dates in comparison to the project baseline. Schedule will be updated on a monthly basis. Deliverables · Invoice and progress reports submitted each month (assume 18 total). · Microsoft Project baseline Gantt chart schedule submitted within one week of NTP. · Microsoft Project Gantt chart updates submitted each month with project invoices (assume 18 total). Task 2 – Coordination Meetings The Consultant will collaborate with City staff and other stakeholders (e.g. WSDOT) via recurring project meetings. Meetings are assumed to occur, on average, once per month (assume 18 months). All meetings are assumed to be held virtually using Microsoft Teams. The kickoff meeting is assumed to last up to two hours. All other meetings in this task are assumed to last up to one hour. Up to six members of the Consultant team. For all other meetings, up to three members of the Consultant team, including the Consultant project manager, will attend. The Consultant will prepare a meeting agenda prior to each meeting and distribute the agenda to all known meeting attendees at least one working day prior to each meeting. The Consultant will document the discussions, COML Council Packet 11-14-23, Page 188 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 3 decisions, and action items from each meeting and distribute meeting notes to all attendees within three business days following each meeting. Meetings listed within other tasks within this Scope of Services are separate from and in addition to the meetings in this task, but they will follow the same agenda and notes procedures outlined here. Deliverables · Meeting agendas outlining likely discussion topics for each project coordination meeting, submitted at least one working day before each meeting (assume 18 total). · Meeting notes documenting each project coordination meeting, submitted within three working days of each meeting (assume 18 total). Task 3 – WSDOT Documentation The Consultant will complete necessary WSDOT documentation to gain approval for the project. During a prior phase of work, Consultant completed an Intersection Control Evaluation (ICE) including traffic volumes analysis and recommendation for roundabout control at the SR 17 and Yonezawa Boulevard intersection. For this phase of work, the Consultant may complete an optional task of revising and resubmitting the ICE for approval if traffic volume projections have changed significantly due to clarity in the adjacent development plans or the ongoing citywide travel demand modeling (occurring under a separate contract). Otherwise, the Consultant anticipates completing two sets of design approvals: design approval (DA) and project development approval (PDA) documents. The DA submittal is anticipated to occur after the 30% design stage (see Task 12) and the PDA submittal is anticipated to occur after the 90% design stage (see Task 14). Additionally, because this project proposes a break in partial limited access to add a new intersection leg, WSDOT region and HQ approval is required. Furthermore, because the project has federal funding, additional WSDOT reviews and approvals are required to obligate funding. This task addresses the necessary design reviews associated with federal funding. See Task 9 for the National Environmental Policy Act (NEPA) work elements. See Task 5 for the relevant right-of-way program elements tied to federal funding. 3.1 Revised Traffic Analysis (Optional Service) If directed by the City in writing, the Consultant will complete an update to the previously approved traffic operations analysis for the intersection. This revision will include the following assessments: · Updated traffic volumes analysis and Sidra modeling to reflect changes to projected volumes due to modified developer plans and/or the citywide travel demand model. · Evaluation of the number of travel lanes necessary to provide sufficient traffic operations and safety performance for all modes for a 20-year planning horizon. If the result of the above analysis is a different number of recommended travel lanes (including the use of slip lanes) then the Consultant will complete the following work elements: · Prepare a summary memorandum explaining the new recommended configuration. This memorandum will be submitted to WSDOT as part of Task 3.2. COML Council Packet 11-14-23, Page 189 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 4 If the result of the revised traffic modeling analysis does not change the lane-configuration recommendation in the previously approved ICE, the Consultant will not prepare any new documentation in this task. Assumptions · New traffic data from the citywide travel demand model will be in the format of existing and future PM peak hour turning movement volumes for the build and no-build scenarios. The Consultant may be required to scale these volumes up to a new future year to comply with WSDOT analysis horizons. · The City will provide the Consultant with the current version of the developer plans for the parcel northeast of the SR 17 and Yonezawa Boulevard intersection. This map will include building types and the necessary metrics (e.g. square footages, number of residential units) for the Consultant to complete a revised trip generation analysis. · Consultant trip generation calculation revisions shall be limited to the parcel northeast of the project intersection; other parcel developments included in the prior memorandum will not be recalculated unless data is directly provided in the citywide travel demand model outputs. Deliverables · Traffic analysis update summary memorandum (if necessary). 3.2 Design Approval WSDOT Roundabout Design Coordination During the development of the 30% design (see Task 12), the Consultant will arrange one virtual meeting between the Consultant, City, and WSDOT, including WSDOT Headquarters (HQ) roundabout design to confirm the elements of the 2D design prior to completing the 30% design. This meeting will be held virtually and include up to three members of the Consultant team. 30% Design Comment Resolution The Consultant will consolidate all comments provided by City on the 30% design submittal into a comments log for tracking and comment responses. The Consultant will prepare a proposed response to each comment received, and then conduct one meeting with City staff (and WSDOT if necessary) to reconcile any outstanding comments. The Consultant shall track all resolution and incorporation of each comment in a comment log. The Consultant shall then revise design files to incorporate the resolved comments as necessary to complete the Design Approval (DA) documentation within this task. DA Documentation The Consultant will prepare the following DA documentation for WSDOT review. This list is based on a preliminary review of the necessary documents for the review. Preparation of additional documents will require an amendment to the Contract. · Table of Contents · Memorandum (WSDOT template) · Vicinity Map · Draft Summary of Design · Draft Design Parameter Sheets · Safety Analysis (from ICE analysis) COML Council Packet 11-14-23, Page 190 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 5 · Draft Design Analysis (assume maximum of two design documentation/analysis packages) · Draft Maximum Extent Feasible Documentation · Draft/Conceptual Intersection Plan for Approval, including turn simulation exhibits and sight distance evaluation exhibits · Draft/Conceptual alignment plans and profiles Deliverables · WSDOT HQ roundabout design meeting agenda and notes. · DA documentation package (multiple files). · Completed comment log from the 30% design submittal. · 30% comment resolution meeting agenda and notes. 3.3 Project Development Approval 90% Design Comment Resolution The Consultant will consolidate all comments provided by City on the 90% design submittal into a comments log for tracking and comment responses. Consultant will prepare a proposed response to each comment received, and then conduct one meeting with City staff (and WSDOT if necessary) to reconcile any outstanding comments. The Consultant shall track all resolution and incorporation of each comment in a comment log. The Consultant shall then revise design files to incorporate the resolved comments as necessary to complete the Project Development Approval (PDA) documentation within this task. PDA Documentation The Consultant will prepare the PDA documentation for WSDOT review following the 90% design submittal City and/or WSDOT review period. The PDA package is assumed to contain revised, updated, or maintained versions of the same list of documents from Task 3.2. This PDA package will also include submittal copies of other documentation requested by WSDOT potentially including environmental (e.g. NEPA) and technical information reports. If the development of such technical information reports are not already a deliverable in another task within this Scope of Services, they will be outside of this Scope and require an amendment to the Contract. Deliverables · Completed comment log from the 90% design submittal. · Comment resolution meeting agenda and notes. · PDA documentation package (multiple files), stamped and signed (as required) by a licensed Washington State professional engineer. 3.4 Local Programs Approval The Consultant will submit the 90% plans and specifications (developed in Task 14) to WSDOT NCR Local Programs for review and concurrence on the federal funding requirements attached to this project. To facilitate this review, the Consultant will complete the Region’s PS&E checklist. The Consultant will consolidate all comments provided by WSDOT Local Programs on the submittal into a comments log for tracking and comment responses. Consultant will prepare a proposed response to each comment received, and then conduct one virtual meeting with WSDOT and City staff to reconcile any outstanding comments. The Consultant shall track all resolution and incorporation of each comment in a comment log. The Consultant shall then revise design files COML Council Packet 11-14-23, Page 191 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 6 within the ad-ready design development (see Task 15) and resubmit the ad-ready documents to Local Programs to facilitate funding obligation. Deliverables · WSDOT NCR PS&E checklist, draft and final (Microsoft word or PDF format). · Completed comment log from the Local Programs design submittal. · Comment resolution meeting agenda and notes. 3.5 Limited Access Approval SR 17 at and around the Yonezawa Boulevard intersection is classified as partial limited access. This project will add a new leg to the intersection, which will require an “access break” and a revised WSDOT limited access boundary line. The Consultant will prepare the intersection (channelization) plan, right-of-way plan, and limited access plan revision request per the requirements listed in Section 530.10(3) of the WSDOT Design Manual. The intersection (channelization) plan will be prepared under Tasks 3.2 and 3.3. The right-of-way and limited access plan will be a combined file prepared under this task. The Consultant will prepare the plan per the requirements of the WSDOT Plans Preparation Manual, Chapter 1. If available from WSDOT, the Consultant will base the plan off of the existing right-of-way and limited access plan for the SR 17 corridor. The right-of-way and limited access plan will show existing and proposed right-of-way and access revision activities near the intersection, including the extension of limited access along the new leg of the SR 17 and Yonezawa Boulevard intersection and any acquisition or easement areas required for the project. Additionally, this task includes up to two meetings with WSDOT (Region or HQ) staff to discuss the access revision process and to resolve comments, if any. The proposed access break may require an access hearing. This Scope of Services does not cover Consultant’s attendance at that hearing. Deliverables · Right-of-way and limited access plan, draft and final. · Limited access coordination meeting agendas and notes (up to two meetings). Task 4 – Utility Coordination Data Collection The Consultant will request plans for above- and below-ground facilities from public and private utilities serving the project area. Franchise utilities will be identified by City staff or discovered during surveying. The Consultant will contact “One Call” to field locate existing underground utilities prior to the geotechnical exploration and will survey above ground and painted utility locations for inclusion onto the base maps (see Tasks 6 and 7). The Consultant will also contact WSDOT North Central Region to request utility franchise agreements in the project vicinity. The Consultant will document all correspondence with utilities in a coordination log. Preliminary Utility Conflict Analysis Based on the 30% design, the Consultant will prepare and submit to the City exhibits illustrating any known utility conflicts or required pothole locations. The Consultant assumes that franchise utilities or the City will obtain COML Council Packet 11-14-23, Page 192 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 7 pothole data for use by the Consultant during design tasks. Consultant-provided potholing is outside this Scope of Services and would require an amendment. Franchise Utility Coordination, Meetings The Consultant will attend City-facilitated virtual project utility coordination meetings (up to two are assumed for this phase of the project). Topics to be covered include anticipated project impacts and schedule, future utility infrastructure, potential conflicts and their resolution, and timeframes required for any anticipated utility relocations. Additionally, the Consultant shall coordinate directly with franchise utilities (as directed by the City) to resolve utility conflicts with the proposed design. Consultant staff time for this task shall be limited to 46 hours. Time in excess of that maximum shall require an amendment. Deliverables: · Utility coordination log submitted electronically in Excel format. · Utility conflict and pothole exhibits. · Utility meeting agendas and notes (up to four meetings). Task 5 – Right-of-Way Program Commonstreet Consulting, LLC (Commonstreet), as a subconsultant to Perteet, will complete the following work elements for right-of-way negotiations and acquisitions. 5.1 Rights of Entry Commonstreet shall coordinate and obtain rights of entry or permits to support the geotechnical explorations and survey field work at up to four parcels. This effort shall include the necessary project management elements described below to complete only the rights of entry. 5.2 Right-of-Way Acquisition (Optional Service) Work under this task shall not commence without written authorization from the City. Prior to this task starting, the City and Commonstreet/Perteet shall negotiate an amendment for the cost of this task. Project Management · Prepare for and attend Right of Way Task Force Meetings as needed. · Respond to inquiries and needs identified by Agency and/or Project Stakeholders. · Provide written and oral status updates. · Maintain quality control/quality assurance protocols in the execution of the right of way task. · Coordinate valuation, and review tasks. Appraisal Coordination · Prepare right-of-way funding estimate compliant with WSDOT requirements. · Coordinate appraisal task and any subconsultants, as necessary; providing all documentation required to complete appraisal reports and integrate findings into documents. COML Council Packet 11-14-23, Page 193 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 8 · Review appraisal/valuation reports for each affected parcel. · Review design elements with Agency’s design team. Negotiations · Review appraisal/valuation reports for each affected parcel, review design elements with design team. · Make at least three meaningful contacts in attempt to reach property owners for settlement, preferably in person. · Negotiate settlements on compensation and conveyance documents terms. · As needed, prepare Administrative Justifications compliant with WSDOT/FHWA requirements. · Facilitate execution of offer package/conveyance documents, deliver executed offer package to Moses Lake for payment processing and recording. As part of Task 5.2, Perteet, as the prime consultant, will assist Commonstreet with the development of necessary exhibits/maps and text descriptions of the proposed project. Perteet will also coordinate with WSDOT for approvals of the funding estimate and right-of-way plan. Assumptions (for all Task 5 work elements): · Review appraisal/valuation reports for each affected parcel, review design elements with design team. · Title reports will be supplied by Moses Lake or Perteet. · Perteet to provide right of way maps or exhibits. · Scope assumes four property ownerships. · Assumes Moses lake to pay any escrow or closing fees. · Assumes four WSDOT compliant Administrative Offer Summaries. Appraisal fees are based on fee schedule of available appraisers at the time of the assignment. · Assumes no relocations. Deliverables (for all Task 5 work elements): · Right-of-way funding estimate. · When/if property owners agree to settlement, executed offer packages. · Complete acquisition files that are WSDOT/FHWA compliant. Task 6 – Topographic Survey and Basemapping OverSite LLC (OverSite), as a subconsultant to Perteet, will complete the following work elements for surveying. Work in this task will utilize and supplement the existing topographic survey provided by the City for the intersection area. The intent of this task is to provide basemapping to support design improvements related to the SR 17 and Yonezawa Boulevard Intersection Improvements project. OverSite will research and compute the underlying right-of-way alignment and margins, recover existing primary survey control, and establish secondary survey control from which detailed topographic mapping will be performed. See Figure 1. COML Council Packet 11-14-23, Page 194 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 9 Figure 1. Survey Area Exhibit. Research Research will be performed to recover underlying and/or adjoining survey control data relevant to the subject survey corridor to assist with the determination of right-of-way alignments and as a check on control datum. Underlying and adjoining surveys will be researched and recovered from the Grant County Auditor’s Record & Parcel Search and used to depict property lines and easements within the survey limits. In addition, the City will order and provide title reports from a local title company for each of the land parcels adjoining and/or underlying the survey corridor. Control Survey GNSS methods will be implemented utilizing the Washington State Plane South Zone Coordinate System, Horizontal datum: NAD 83(2011), Vertical datum: NAVD 88 (Geoid 18), in units of USFT as the basis for all coordinates and elevations. Existing survey control monuments within one-quarter mile of the project, as referenced on the Washington Geodetic Survey website, will be located as part of the control survey. Existing street monuments underlying or closely adjoining the project corridor will be located as will existing property corners. Auxiliary survey control will be established within the project limits as needed to perform the topographic survey. Additionally, two temporary benchmarks (TBMs) will be established for use in future construction. COML Council Packet 11-14-23, Page 195 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 10 Sub-Surface Utility Location OverSite will not coordinate sub-surface utility locates as part of this scope. If they are needed, the City or Perteet will have to coordinate that effort and OverSite will observe any paint already on the ground while conducting the field survey and incorporate that data into the basemap. Topographic Field Survey A topographic survey sufficient for the development of 1-foot contours will be conducted across the proposed corridor (at 20’ grid intervals) as depicted in the Survey Area Exhibit. The survey will locate features as described below: · Gravity systems, i.e. storm drain and sewer, shall be surveyed to the next downstream structure beyond the limits of the survey corridor. · Sanitary sewer and storm drain structure inverts will be measured to the extent possible without entry into the structure, defined as confined space entry, which Consultant personnel are not certified to perform. Manhole structure diameter, pipe diameters and direction, manhole lid orientation (offset) and pipe material will be noted. · Water valve manholes will be measured to bottom of structure and top of actuator nut. · Utility vaults over 4.0’ in width will be measured horizontally with a measure down to bottom of vault except where safety is a concern, for example electrical vaults with exposed contacts. · Water meters will be located throughout the proposed corridor. · Visible evidence of utility trenches such as patches in asphalt or concrete will be located with the width noted. · Spot elevations will be collected at a maximum spacing of 50-feet within the existing road prism and 25- feet in areas outside of the prism with additional spots as required to adequately identify grade breaks and other topographic features. · Sidewalks, curbs (with type noted), driveways and curb ramps will be located as will pavement edges with type of paving noted. · At curb ramps, spot elevations will be taken at top/bottom of ramp, all grade breaks and grade transitions, and at curb transitions. · Fences and walls shall be described as to type and other identifiable features, i.e. 6’ high chain-link, 4’ high wooden, etc. · Street channelization, crosswalks and parking space lines will be located to reflect existing conditions. · Lane markings, such as directional arrows and bike lanes will be located. · Traffic signs will be located and labeled as to their type; i.e. stop, yield, bike lane, etc. · Significant trees with a 6” or greater caliper when measured 4.5 feet above natural ground will be located with drip-line noted. · Survey will also include, but not be limited to: o Grade breaks o Top and bottom of retaining walls o Top and bottom of curbs o Limits of shrubs, vegetation and landscaping limits o Buildings and structures, with finish floor elevations COML Council Packet 11-14-23, Page 196 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 11 o Fences and gates o Utility access points - cleanouts, hand-holes, traffic signal control vaults, etc. o Irrigation control valves o Traffic signal, power, telecommunication and luminaire poles o Fire hydrants o Fire department connections and detector check vaults o Sub-Surface utility locations marks as delineated by a professional locating service o Street monuments, existing property corners and survey control points Survey Basemapping A topographic survey map will be prepared in AutoCAD Civil 3D format depicting all features located during the field survey as well as 1-foot contours and computed parcel and right-of-way lines. More specifically: · Basemap shall incorporate field-located utility appurtenances, sub-surface utility paint marks, and GIS or as-built information provided by the City. · Surveyed points will be shown to the nearest 0.01’ on hard surfaces and 0.1’ on unpaved surfaces. · Manholes: o Inverts will be shown for all pipes into or out of structures detailing pipe diameter and direction of pipe. o Manhole labels will also include manhole numbers that correspond to the City GIS ID for the structure (if available) with nominal diameter of manhole as measured in the field. o Pipe connections shown on the plan will be to center of structure rather than center of access lid. · Commercial meter vaults and other below grade structures 4’x4’ and larger shall be shown to scale and bottom of vault elevation noted. · Water line appurtenance symbols shall be per APWA standards and shown to a reasonable scale on plans. · Lane striping and parking striping shall be shown as it appears in the field. · Dashed striping shall be shown as a dashed line and solid striping as a continuous line. · Breaks in lane striping, such as left turn lanes that have a break in the line to allow vehicles to enter the lane, shall show true location of where lane striping starts and stops. · Traffic signals will be shown using standard traffic symbols for mast arms, lights, signal heads, and pedestrian buttons. · All line work will be in model space. Drawing units shall be U.S. Survey Foot. · An electronic copy of the triangulated irregular network (TIN) will be provided. · APWA CAD standards for layers and symbols will be used. Legacy Survey Data Integration Incorporate any usable data from the limited boundary & topographic survey (120’ cross section spacing) provided by the City of Moses Lake. · Convert the current linework/blocks/text into APWA Layering utilizing CAD template provided by Perteet. COML Council Packet 11-14-23, Page 197 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 12 Legal Descriptions & Exhibits Prepare legal descriptions and easement/acquisition maps for up to four parcels. Produce a draft and final version for each burdened parcel (up to four). sUAS Photogrammetry Provide high-quality aerial image that is geo-rectified and tied to established control. Survey QA/QC of Deliverables An internal Consultant quality assurance/quality control review of deliverables will be conducted, as well as confirmation that comments received have been addressed. A record of comments received will be maintained. Response to each comment received will be tracked to confirm that they have been addressed Assumptions: · Right of entry will be provided to OverSite. Others will take the lead on coordinating directly with right-of- entry for landowners refusing entry. In no case shall survey personnel enter private property prior to the right of entry being obtained. · Consultant’s personnel are not certified for confined space entry and as such utility manholes may only be measured from the surface. Invert elevations up to a depth of 25 feet will be measured with an electronic dista-meter with IMU tilt compensation. · The City will order and provide title reports for each of the land parcels adjoining and/or underlying the survey corridor. Deliverables: · A digital copy of the survey drawing, provided in AutoCAD Civil 3D format. · LandXML files. · Copies of field notes. · Point list in asci or text format, comma delimited. · Traffic Control Plan (TCP) for approval. Task 7 – Geotechnical Investigations HWA GeoSciences Inc. (HWA), as a subconsultant to Perteet, will complete the following work elements for geotechnical design support. Project Management · Project Setup: HWA will initiate the project and set up billing information in support of invoicing throughout the project. · Project Management: HWA will provide project management including communications and coordination with the design team. HWA will provide task management to all geotechnical related aspects of the project. HWA will correspond with the design team in the form of meetings, emails, and telephone calls, as necessary. · Invoice Generation and Processing: HWA will prepare monthly invoices, and progress reports for the duration of the design phase of the project. COML Council Packet 11-14-23, Page 198 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 13 · Design Team Meetings: HWA will attend up to four meetings, each 1 hour in duration. Up to two geotechnical Consultant staff will attend each coordination meeting. Field Explorations: · Collect and Review Available Geotechnical Data: HWA will review readily available geotechnical information along the project corridor. This review will include online geotechnical databases, geologic maps, and HWA library. · Perform Geotechnical Site Reconnaissance and Mark Utility Locates: HWA will conduct a geotechnical site reconnaissance of the project area. This reconnaissance will be used to identify geotechnical challenges and to assist in planning the geotechnical exploration program. While on site, HWA will mark the proposed exploration locations and arrange for utility locates using the Utility Notification Center. HWA assumes load/unload and travel to site requires 4 hours in each direction. · Plan Geotechnical Field Exploration Program: HWA will plan and coordinate the geotechnical exploration program for the project. The exploration program will consist of conducting 1.5 days of geotechnical borings, and 1 small-scale pilot infiltration test to provide data for design of the proposed improvements. The planning efforts include coordination with varies subcontractors and the City of Moses Lake. · Generate Exploration Work Plan Memorandum: HWA will prepare a Geotechnical Work Plan Memoranda, which will include a project specific Health and Safety Plan, for the proposed field work. The work plan will be submitted to the design team and appropriate jurisdictions for review and approval. The work plan will detail the type, location, and extent of proposed field explorations along with logistics necessary to perform the work such as traffic control plans and staging areas. The work plans will also be used for utility locating clearances and for permitting that may be necessary to access the exploration locations. We assume the required permits or rights of entries will be provided at no cost to HWA. · Conduct Geotechnical Explorations: HWA will conduct 1.5 days of drilling consisting of up to 3 geotechnical borings along the alignment of proposed improvements to assess the subsurface soil and groundwater conditions. The proposed borings will be advanced to a depth of 20 feet or the practice refusal of the drilling equipment whichever is shallower. All borings will be drilled within the Right-of-Way or easements of City of Moses Lake. All borings will be drilled using a track-mounted limited access hollow stem auger drilling equipment. One groundwater monitoring piezometer will be installed at a selected boring location to assist with the groundwater monitoring. · HWA assumes conducting the proposed geotechnical borings will take 1.5 working day to complete not including travel time and the work will NOT require traffic control flaggers. HWA assumes load/unload and travel to site requires 4 hours in each direction. · Each of the above-described geotechnical explorations will be logged by an HWA geotechnical engineer geologist. · Conduct Groundwater Monitoring: HWA will install groundwater monitoring transducer and barologger in the monitoring well. The transducers will be set to take groundwater elevation readings every half an hour for 1 year. HWA will make site visits to download and process the groundwater data. This data will be used to provide the designer and prospective contractors with seasonal groundwater variations across the site. No environmental groundwater monitoring wells will be installed as part of this scope of services. HWA assumes two site visits to verify the status of transducers, download the data, and analyze the data. HWA assumes load/unload and travel to site requires 4 hours in each direction. COML Council Packet 11-14-23, Page 199 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 14 · Conduct Pilot Infiltration Testing: HWA will conduct 1 small-scale Pilot Infiltration Test (PIT) at the location of the desired infiltration facility for the project to determine the design infiltration rate. The PIT will be conducted in accordance with the Washington State Department of Ecology Stormwater Manual for Eastern Washington. · HWA assumes conducting the proposed PIT will take 1.5 working days to complete not including travel time and the work will NOT require traffic control flaggers. HWA assumes load/unload and travel to site requires 4 hours in each direction. · Generate Exploration Logs and Assign Laboratory Testing: HWA will prepare summary boring and test pit logs and perform laboratory testing to evaluate relevant physical properties of select soil samples. Laboratory testing will include moisture content and grain-size distribution. Geotechnical Engineering Design Services: · Evaluate Geotechnical Field and Laboratory Data: Based on the borings and the laboratory test results on selected samples, HWA will generate estimates of the soil strength and other properties needed to evaluate the effects the subsurface conditions will have on the proposed improvements. · Develop Geologic Cross-Sections: HWA will construct one geologic cross-section, as needed, for the project. The cross-section will show near surface soil conditions and will be provided in a geotechnical report. · Generate Seismic Design Parameters: Based on the soils encountered along the alignment, HWA will determine the Site Class for seismic design. The design spectral acceleration parameters will then be selected in accordance with the AASHTO Specifications for Road and Bridge. · Preliminary Infiltration Analyses and Recommendation: HWA will conduct grain size analysis screening to develop general recommendations for stormwater infiltration and provide theoretical infiltration rate to be used for preliminary assessment and sizing of infiltration facilities. · Pilot Infiltration Testing Analyses and Recommendation: HWA will analyze and evaluate the results of the pilot infiltration testing program and develop design infiltration rate for proposed infiltration facility. · Luminary Foundation Analyses and Recommendation: HWA will provide geotechnical recommendations for design and construction of the luminaire improvements. We assume that luminaire foundations will be designed based on WSDOT standard plans and procedures. · Embankment Analyses and Recommendation: HWA will conduct stability, settlement, and consolidation analyses for the proposed embankments, and provide geotechnical recommendations for design and construction of the proposed embankments. · HWA QA/QC: All design calculations and recommendations will be reviewed by a senior principal prior to distribution to the design team. · Prepare Draft Geotechnical Engineering Report: HWA will prepare a draft geotechnical engineering report for the project. This report will contain the results of the explorations and testing including descriptions of surface and subsurface conditions; a site plan showing exploration locations and other pertinent features; summary exploration logs; and laboratory test results. The report will also include the results of our engineering analyses and provide geotechnical recommendations for the proposed improvements. · Respond to Geotechnical Related Review Comments: HWA will provide written responses to all review comments. The written responses shall be provided in the form of emails to the design team. COML Council Packet 11-14-23, Page 200 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 15 · Prepare Final Geotechnical Engineering Report: HWA will prepare a final geotechnical engineering report for the project once review comments are provided. · Geotechnical Plan and Specification Review: HWA will collaborate with the design team to verify that the geotechnical engineering requirements are properly incorporated into the plans and specifications. Deliverables: · Monthly status reports and invoices. · Subsurface Exploration Work Plan Memorandum. · Draft and Final Geotechnical Engineering Report. Assumptions: · No geotechnical data report or baseline report will be generated as part of this work. · Site reconnaissance is limited to observation of existing topography and features; no excavation or subsurface exploration will be conducted during site reconnaissance. · Explorations will be conducted within the Right-of-Way of City of Moses Lake. · Boring locations will be accessible by track-mounted drill rigs. · Boring locations will be located using handheld GPS and measurement from existing known features. · Utility locates, via the One-Call Utility Locate Center will be comprehensive and accurate enough to allow reliable and safe location of borings. Vacuum extraction of borings is not included. · The geotechnical explorations proposed herein will not be used to assess site environmental conditions. However, visual or olfactory observations regarding potential contamination will be noted. Analysis, testing, storage, and handling of potentially contaminated soil and ground water (either sampled or spoils from drilling) are beyond this scope of services. If contaminated soils and/or ground water are encountered, the material will be properly contained on-site for disposal as mutually agreed upon without additional cost to HWA. · All non-contaminated drilling spoils and related debris will be drummed on site and transported off site for disposal by the drilling subcontractor. · HWA assumes no concrete pavement below the surface asphalt and assumes that coring will not be required prior to drilling the proposed borings. · No Phase 1 or Phase 2 Environmental Site Assessment will be completed by the HWA. · All required rights of entry will be provided by others at no cost to the HWA. · All required street use permits will be provided by others at no cost to the HWA. · All geotechnical borings and pavement cores conducted through the pavement and pavement cores will be patched with quick drying cement or Aquaphalt. Saw cutting of the pavement or hot mix asphalt patches will not be completed. · The borehole locations will be surveyed by others. · Soil samples will be collected from the borings using the Standard Penetration Test (SPT) at intervals of 2.5 feet or 5 feet. · All geotechnical soil samples will be disposed after 6 months of being collected. Long-term storage of soil samples is not included. COML Council Packet 11-14-23, Page 201 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 16 · The City will facilitate Subcontractor and its subcontractors’ access to the planned of borings. · All field works will be accomplished during normal daylight workdays and hours, with at least a minimum 8 hours available per day. · The monitoring well installed as part of the field explorations will be maintained throughout design and abandoned by others during the construction. · Neither site specific PSHA nor site specific response analyses are included in this scope. · Pavement investigation and pavement design is not part of this scope of work. Task 8 – Public Outreach Program The Consultant will lead an outreach program to build community support and increase regional awareness of the project. The program will include ongoing work elements in addition to specific events. Public outreach during the construction phase of the project will require an amendment to this Scope of Services. 8.1 Public Outreach Strategy The Consultant will work with the City to fully develop a public outreach strategy that outlines the public involvement goals, target audiences, outreach process for the project, and how public input will be addressed during the design process. This information will all be discussed and decided upon at a virtual meeting between three members of the Consultant team and City staff. The discussions will be documented via meeting notes. Deliverables: · Public outreach strategy meeting agenda and notes. 8.2 Project Website The Consultant will prepare text and graphics—such as a vicinity map or concept sketches—for a project website. The City will build the project website on their website platform; the Consultant will not operate or maintain the website. The Consultant will provide updated material during the design and right-of-way phases of the project when requested by the City. The Consultant will prepare the website text in English and, if requested, Spanish. If other languages are required, the City will complete translation services. Deliverables: · Website text submitted electronically in Word or Outlook format. · Website maps and/or exhibits. 8.3 City Council Briefing and Open House City Council Briefing The Consultant will prepare presentation materials for one City Council briefing. Presentation materials are anticipated to be slideshow presentations. If desired by the City, the Consultant will present to the City Council at COML Council Packet 11-14-23, Page 202 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 17 the briefing. (Consultant attendance would be in person.) The Consultant and City will rehearse the presentation at up to two, one-hour-long meetings. Public Open House Attendance and Materials A public open house will occur concurrent with the City Council meeting outside of the Council chambers. The Consultant team will also attend the open house. The Consultant will prepare display boards and roll plot exhibits for the open house and attend in person with up to two Consultant team members (including the Consultant project manager, who may be asked to present to Council). Public Open House Notifications The Consultant will prepare materials to notify the public about the open house and to request public participation at the event. Specific notification methods will be confirmed during the development of the public outreach plan, but the level of effort for this task is based on the assumption of using a mailer (such as a postcard) as the primary notification element the Consultant will develop in this task. The mailer is anticipated to be approximately postcard size and may be double sided. The Consultant will prepare PDFs or InDesign files of each side of the mailer and develop the text and graphics to include on it. The Consultant will prepare a draft version of the mailer and submit that for City review and comment and then prepare an updated mailer based on comments. The Consultant will prepare the mailer with English and Spanish text. If other languages are required, the City will complete translation services. The Consultant scope for this task will be limited to developing the mailer PDFs or InDesign files. The City will be responsible for compiling addresses for recipients, printing, and mailing/distributing as well as all associated costs, such as postage. In addition to development of a mailer, the Consultant will provide text for the City to include in other notifications, such as online social media posts. The Consultant will not develop any new graphics for these additional notification methods but the City may use graphics developed in other tasks of this Scope of Services as desired. Deliverables: · City Council briefing slideshow submitted electronically in PowerPoint format. · Public open house prints (display boards, roll plots, sign-in sheets, comment forms, etc.). · Draft public open house mailer. · Final public open house mailer. · Text for other notifications by the City. Task 9 – Environmental Documentation and Permitting The Consultant will provide National Environmental Policy Act (NEPA) and State Environmental Policy Act (SEPA) environmental documentation and permitting assistance for required federal, state, and local permits, as required by the various resource agencies. 9.1 Background Information Review and Analysis COML Council Packet 11-14-23, Page 203 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 18 The Consultant will obtain project and resource information relevant to the environmental context of the project action, inclusive of resource agency database review of available information on historical/cultural resources, Ecology facilities, priority/threatened/endangered species, and information from the design team applicable to the environmental context to begin document preparation or exclusion documentation/consideration. Assumptions: · No permits or documents outside of this task are assumed. · Environmental review will be adequately addressed with documents provided under this task and associated with other in-scope documents. Deliverables: · No specific deliverables for this task. 9.2 WSDOT Early Coordination with City A Categorical Exclusion (CE) form will be preliminarily drafted and a virtual meeting will be scheduled by the Consultant with the City and WSDOT staff to consider categorical exclusions and the extent of any requested supplemental documentation for: hazmat review, noise analysis, environmental justice, cultural resources, endangered species, and other CE classification categories under WSDOT NEPA CE review. Assumptions: · One meeting will be attended with WSDOT staff, City staff, and Consultant staff (assumed to include the project manager or lead engineer, the environmental planning lead, and the right-of-way consultant). The meeting will be virtual. · The meeting may occur at or before the 30% design level and project guidance will be based on preliminary design knowledge. · It is assumed that an air analysis will not be required for this project. Deliverables: · Early coordination meeting agenda and notes. 9.3 NEPA CE Form The Consultant will prepare a preliminary and final CE form for submittal to WSDOT at the 60% design level inclusive of discipline memos. Assumptions: · Coordination will occur with WSDOT after submittal to respond to review comments. One revision to the CE form is assumed. · Once WSDOT agrees the CE form and other supporting documents under this task are complete, they will request the CE be signed by the City for final submittal. COML Council Packet 11-14-23, Page 204 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 19 Deliverables: · Draft and final CE form to City and WSDOT with attachments. · Comment responses in WSDOT-provided format. 9.4 SEPA Checklist The Consultant will prepare a draft and final SEPA checklist for City use at the 60% design level inclusive of NEPA discipline memos and related project documents under this scope of work as supporting information. Assumptions: · SEPA determination will result in Exemption, a Determination of Non-Significance (DNS) or Mitigated Determination of Non-Significance (MDNS). · City will provide one consolidated review on the draft checklist prior to being finalized by the Consultant. · City will address SEPA public notice requirements. · SEPA will not be appealed. Deliverables: · Draft and final SEPA checklist. 9.5 Area of Potential Effect (APE) and Cultural Resources Assessment (CRA) APE Memo and WSDOT Support The Consultant will prepare an Area of Potential Effects (APE) for the proposed improvements, which includes a brief memorandum describing the project, proposed direct and indirect effects, and a map that shows the boundaries of those potential effects. The memorandum will be prepared in coordination with City and WSDOT for submission to Section 106 consulting parties, including SHPO, FHWA, and Affected Tribes. Services included in this task include review of project specifications, available geotechnical information, preliminary review of background information on the natural and cultural setting of the project, drafting and producing the APE memorandum and map, and completing revisions of the draft that may be needed to prepare a final APE memorandum. Assumptions: · The entire APE will be accessible for the field survey. · The City will provide one consolidated review on the draft APE prior to being finalized by the Consultant team for WSDOT submittal. Deliverables: · Draft and Final APE. Cultural Resources Field Survey and Report Based on preliminary project plans, Perteet anticipates a cultural resources survey and assessment will be required to support Section 106 compliance. If it is deemed necessary as a result of consultation with the DAHP, and Tribes, the Consultant will conduct pedestrian survey of the APE including pedestrian survey and excavation of up to six shovel probes in areas free of impervious surfaces and buried utilities, particularly the COML Council Packet 11-14-23, Page 205 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 20 previously undeveloped area northeast of the intersection. If archaeological material is encountered, it will be documented to the extent feasible at the time of the survey. However, no artifacts or other material will be collected. Perteet will prepare a technical report that meets WSDOT, federal, and SHPO/DAHP standards. The report will describe the APE, its natural and cultural setting, field survey methods and results, and provide an evaluation of the likelihood for the project to adversely affect cultural resources. If an archaeological resource is identified during the survey, it will be documented on a standard Washington State Archaeological Site or Isolate inventory form and appended to the report. One internal draft report will be prepared and submitted electronically for review. One final draft will be submitted to reviewing agencies. One final version will be prepared based on reviewer comments and submitted electronically as a PDF document. Assumptions: · The City will provide one consolidated review on the draft CRA prior to being finalized by the Consultant team for WSDOT submittal. · The City will mark the APE with white paint for the utility locate. · No Historic buildings will be evaluated or recorded. · If at any time human remains are encountered, work will cease, and local law enforcement, the DAHP, WSDOT, and affected Tribes will be notified. · Up to one site inventory form will be completed; if multiple sites are identified, a budget adjustment would be required to complete documentation. · If any archaeological resources are identified during the field survey, they will be documented to the extent allowed by survey data. Additional boundary definition, significance testing, or development of a treatment plan would be conducted under separate scope/cost; and · WSDOT will conduct formal Tribal Consultation required for compliance with Section 106. Deliverables: · Draft and final CRA. 9.6 Environmental Justice (EJ) An EJ memo with related maps, figures, and tables be prepared to evaluate disadvantaged populations and impacts that may occur in the context of the project action pursuant to CE review criteria. Assumptions: · The City will provide one consolidated review on the draft EJ memo prior to being finalized by the Consultant team for WSDOT submittal. Deliverables: · Draft and final EJ memo. 9.7 Environmental Noise Evaluation Michael Minor & Associates (MM&A), as a subconsultant to Perteet, will provide a memorandum outlining why a noise study is not needed for the SR 17 and Yonezawa Boulevard Intersection Improvements project. COML Council Packet 11-14-23, Page 206 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 21 Noise Screening: Type 1 The analysis will be based on the guidelines presented in the current Federal-Aid Policy Guide, Subchapter H, Part 772, Procedures for Abatement of Highway Traffic Noise and Construction Noise (FHWA 2010) and the 2011 Traffic Noise Policy and Procedures (WSDOT 2012). The SR 17/Yonezawa Boulevard Intersection Improvements project will be reviewed to determine the level of noise analysis required under the FHWA and WSDOT policy. Under FHWA and WSDOT, only projects that are determined to be a Type 1 project are required to have a detailed noise study. For a project to be considered Type 1, the project must meet one or more of the following criteria: 1. The construction of a highway on a new location; or, 2. The physical alteration of an existing highway where there is either: • Substantial Horizontal Alteration. A project that halves the distance between the traffic noise source and the closest receptor between the existing condition to the future build condition. • Substantial Vertical Alteration. A project that removes shielding, therefore exposing the line-of-sight between the receptor and the traffic noise source. This is done by either altering the vertical alignment of the highway or by altering the topography between the highway traffic noise source and the receptor; or 3. The addition of a through-traffic lane(s). This includes the addition of a through-traffic lane that functions as a HOV lane, High-Occupancy Toll (HOT) lane, bus lane, or truck climbing lane; or, 4. The addition of an auxiliary lane, except for when the auxiliary lane is a turn lane; or, 5. The addition or relocation of interchange lanes or ramps added to a quadrant to complete an existing partial interchange; or, 6. Restriping existing pavement for the purpose of adding a through-traffic lane or an auxiliary lane; or, 7. The addition of a new or substantial alteration of a weigh station, rest stop, ride-share lot, or toll plaza. If a project is determined to be a Type I project under this definition, then the entire project area as defined in the environmental document is a Type I. The initial review of the project area indicates that the proposed project will not meet these criteria on any noise- sensitive properties as defined under FHWA and WSDOT policy. The project will not add any new through lanes and does not appear to change the vertical or horizontal alignment sufficiently to meet Type 1 requirements (half the distance to the travel lanes or expose a previously shielded receiver). A review of future planned and permitted uses will be performed to identify any new noise sensitive properties. The noise technical memorandum will be submitted in Microsoft Word format for review and comments. After revisions based on the comments are completed, a final memorandum will be produced in PDF electronic format. Assumptions: · A review of planned and permitted properties will be performed to identify any potential new noise sensitive land uses. · CAD files (MicroStation or Civil 3D) will be provided by the Consultant. · If it is determined that the project meets the Type 1 requirements, then additional noise analysis may be required that is outside of this Scope of Services. COML Council Packet 11-14-23, Page 207 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 22 Deliverables: · Draft noise memorandum submitted electronically in Word format. · Final noise memorandum. 9.8 Biological Assessment (BA) No-Effect A BA species review and no-effect checklist will be prepared to evaluate threatened/endangered that may occur in the context of the project action pursuant to CE review criteria. Assumptions: · City will provide one consolidated review on the draft BA no-effect letter prior to being finalized by the Consultant team for WSDOT submittal. · Infiltration is assumed for stormwater and formal ESA consultation is not assumed for this task or scope. If formal ESA consultation is triggered a supplemental scope will be necessary for formal BA preparation if recommended by WSDOT under NEPA review. Deliverables: · Draft and final BA no-effect checklist associated with CE form. 9.9 Hazardous Materials Investigation and Technical Memorandum The primary objective of the Hazardous Materials Technical Memorandum is to evaluate the project area, with focus on the historic and current use of the properties adjacent to the proposed project corridor, for obvious evidence of existing and potential hazardous materials conditions. The Hazardous Material Technical Memorandum will be completed in support of the National Environmental Policy Act (NEPA) documentation for the project. The Hazardous Materials Technical Memorandum will include the following elements: · Review of federal, state, and local agency environmental regulatory databases for the project corridor area and adjoining properties focusing on the identification of any record of the presence of hazardous substances, underground storage tanks (USTs), or hazardous substance spills · Review of historical documentation, including: o Historical aerial photographs o Sanborn Insurance Maps, if coverage is available o Reverse city directories for the streets included in the project area · Review of existing reports documenting previous investigations (if available from Washington State Department of Ecology and/or City of Redmond) · Site reconnaissance from public rights-of-way or publicly accessible public properties · Prepare draft and final Hazardous Materials Technical Memorandum deliverable A Hazardous Materials Technical Memorandum is not considered to be a Phase I ESA that adheres to the American Society for Testing and Materials (ASTM) standards. If the Hazardous Materials Technical Memorandum analysis reveals issues that could impact the project area, more detailed investigations, which may include Phase I ESAs or Phase II ESAs, may be recommended. If further investigation is recommended, a scope of work and cost estimate will be provided at that time. COML Council Packet 11-14-23, Page 208 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 23 The Hazardous Materials Technical Memorandum scope of work does not include any specific testing or analysis to determine the presence or absence of any physical, radiological, or biological hazard or condition, including, but not limited to: wetlands, endangered species issues, asbestos containing materials, lead-based paint, lead in drinking water, or radon. The Hazardous Materials Technical Memorandum and any further recommended investigations (if deemed necessary) will be performed by HWA staff who, to the best of our professional knowledge and belief, meet the definition of Environmental Professional as defined in §312.10 of 40 CFR 312. HWA staff members have the specific qualifications based on education, training, and experience to assess a property of the nature, history, and setting of the project area. Assumptions: · City will provide one consolidated review on the draft Hazmat memo prior to being finalized by the Consultant team for WSDOT submittal and NEPA review. Deliverables: · Draft and final Hazmat memo. Task 10 – Storm Drainage Design The CONSULTANT will develop preliminary and final design for conveyance, runoff treatment and flow control for the work described in this supplement. Use of Low Impact Development (LID) BMPs will also be evaluated within the project area. Drainage design work will be documented in a Type A Hydraulic Report. Task 10.1 – Off-Site Analysis Perform off-site Analysis and generate associated figures for inclusion into the preliminary and final Hydraulic report. Assumptions: · Access to WSDOT right-of-way as part of the Off-Site analysis will be coordinated with the STATE. If access onto upstream and downstream private property is necessary, CONSULTANT to coordinate through the CITY. · Up to two total downstream flow paths will be analyzed for a total distance of one quarter mile each from the project site. · Downstream conveyance systems do not require improvements or modifications. Task 10.2 – Threshold Analysis Perform threshold analysis. Measure and sum up the existing, new and replaced impervious (both PGIS and NPGIS) surfaces for the project in CAD. Fill out the WSDOT Stormwater Design Documentation Spreadsheet in order to confirm the minimum requirements that will apply to each Threshold Discharge Area (TDA). Includes updates to this spreadsheet if design changes occur in the later design phases. TDA confirmation using available basemap, as-built, GIS and contour information in accordance with the WSDOT Highway Runoff Manual. COML Council Packet 11-14-23, Page 209 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 24 Generate the necessary mapping to include in the Hydraulic Report, including basin maps, TDA maps, existing condition maps, existing and proposed impervious area maps. Update the WSDOT Stormwater Design Documentation Spreadsheet (SDDS) based on design changes made during the 60%, 90% and ad-ready design phases. Deliverables: · Existing and change in land use cover maps (to be included in the Hydraulic Report). · Stormwater Design Documentation Spreadsheet (to be included in the Hydraulic Report). Task 10.3 – Flow Control and Water Quality Treatment Calculations Perform runoff treatment and flow control facility sizing calculations based on the project footprint. This includes updates to runoff treatment and flow control calculations as needed for design changes that occur during 60%, 90% and ad-ready design phases. Modification to existing stormwater facilities to meet project requirements may be considered if feasible. Coordinate with the project geotechnical engineer to evaluate infiltration feasibility. Prepare a geotechnical investigation request for each flow control and runoff treatment facility. The request will include facility type, approximate location and the approximate facility bottom elevation with respect to existing grade. Establish equivalent area capture for each flow control and water quality facility. Assumptions: · Coordination for Pilot Infiltration Test (PIT), if needed, is included. · HIRUN modeling and dewatering plans are not included. · Hydraulic modeling for wetland mitigation areas will not be required. · Flow control and water quality treatment sizing calculations will be performed using an approved modeling software appropriate for this region. Deliverables: · Flow control and water quality treatment calculations (to be included in the Hydraulic Report). · Geotechnical investigation request. · Equivalent area capture maps (to be included in the Hydraulic Report). Task 10.4 – Conveyance Calculations Perform storm drain and ditch conveyance calculations for the proposed storm drain system improvements. Update the calculations as needed, based on design changes made during the 60%, 90% and ad-ready design phases. Perform inlet spacing (gutter flow) calculations for those areas of the project site where new catch basins will be installed and also those areas where catch basins exist and roadway shoulder widths have decreased as part of COML Council Packet 11-14-23, Page 210 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 25 the project improvements. Update the calculations as needed, based on design changes made during the 60%, 90% and 100% design phases. Assumptions: · Conveyance calculations will be performed using StormShed3G modeling software. · Inlet spacing calculations will be performed using the WSDOT inlet spacing spreadsheet. Deliverables: · Conveyance calculations (to be included in the Hydraulic Report). · Inlet spacing calculations (to be included in the Hydraulic Report). Task 10.5 – Hydraulic Report Prepare a preliminary and final stamped Type A Hydraulic Report, including appendices. Assumptions: · The Preliminary Hydraulic Report will be submitted with the 60% design plans and finalized with the ad-ready design documents. · Any comments or modifications to the Hydraulic Report after WSDOT and CITY concurrence of the Final submittal will be considered supplemental work. · Stormwater manager and design engineer will attend up to three virtual coordination meetings with WSDOT and/or City staff. · All reports will be submitted in PDF format. · Hydraulic Report format to follow will be the Type A WSDOT Hydraulic Report format. · Drainage design will be based on the 2019 Highway Runoff Manual and the 2023 Hydraulics Manual. Deliverables: · Preliminary Type A Hydraulic Report. · Final Type A Hydraulic Report. Task 11 – Landscaping, Irrigation, and Urban Design Hough Beck & Baird Inc. (HBB), as a subconsultant to Perteet, will complete the following work elements for landscaping, irrigation, and urban design. 30% Submittal · Prepare monthly invoices and progress reports. · Attend a virtual kick-off meeting with the design team and the City of Moses Lake. · Concept development to provide enhancements to the center island in compliance with WSDOT Design Manual Chapter 950. Includes development of initial Public Art Plan and coordination for the Initial Art concept review by WSDOT’s Public Art Specialty Services Team. · Prepare and attend one Planning Commission meeting, to present the roundabout design as identified in this task. COML Council Packet 11-14-23, Page 211 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 26 · Prepare 30% cost estimate for planting and irrigation. · Prepare for and attend up to two meetings with design team, city staff and/or regulatory agencies. The consultant project manager for Perteet, as the prime consultant, will also attend the Planning Commission meeting and present if requested by the City. 60% Submittal · Prepare monthly invoicing and progress reports. · Prepare 60% Landscape Plans (5 sheets) · Prepare 60% Irrigation Plans (5 sheets) · Prepare 60% cost estimate for planting and irrigation. · Prepare draft special provisions based on 60% design documents. · Prepare for and attend up to two meetings with the design team, city staff and/or regulatory agencies. · Coordination with WSDOT and updates to the Public Art Plan for the Selected Art Concept Review. 90% Submittal · Prepare monthly invoicing and progress reports. · Prepare 90% Landscape Plans (5 sheets) · Prepare 90% Irrigation Plans (5 sheets) · Prepare 90% cost estimate for planting and irrigation. · Prepare draft special provisions based on 90% design documents. · Prepare for and attend up to one meeting with the design team, city staff and/or regulatory agencies. · Coordination with WSDOT and updates to the Public Art Plan for the Final Proposed Art review. Ad-Ready Submittal · Prepare monthly invoicing and progress reports. · Prepare Final Landscape Plans (5 sheets) · Prepare Final Irrigation Plans (5 sheets) · Prepare Final cost estimate for planting and irrigation. · Prepare final special provisions based on final design documents. Assumptions: · The task fee assumes that the project will be developed as a single package. Bid alternates, bid additives, or subsequent repackaging of the project into separate phases is not include. · Planning Commission Presentations include developing figures and PowerPoint presentation to present virtually for a meeting duration of up to 1 hour to confirm design direction and development. Graphics are limited to one color rendered plan, one color rendered section, and images of proposed planting and urban design materials, and the proposed Public Art Plan. · All meetings are assumed to be virtual. · 60% Irrigation Plans will include preliminary head layout, point of connection location, details and schedule. · Specifications will be special provisions based on the latest version of the Washington State Standard Specifications, incorporating City of Moses Lake or Regional Special Provisions. COML Council Packet 11-14-23, Page 212 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 27 · HBB will provide design input to Perteet on urban design details to be prepared by Perteet in Tasks 12 through 15. · Public art will be included in the project as coordinated with WSDOT and the City per WSDOT’s Design Manual Chapter 950. It is understood no public artist is planned to be involved in the project and the “art” for the project area will be considered enhancements developed by the landscape architect (HBB). These enhancements will provide an inviting and welcoming aesthetic, limited to natural materials, earthwork, boulders, concrete, and metal elements that are not typical WSDOT treatments and thus require WSDOT review and approval. The approved Public Art Plan will be incorporated into the PS&E submittal documents as an attachment to the specifications. Tasks 12 through 15 – Final Design Table 1 shows the anticipated plan sheets that the Consultant will prepare for the various design phases (see Tasks 12 through 15). It is assumed that the plans will fit on three “base sheets,” utilizing 11” x 17” sheets at 1” = 40’ scale. Other scales may be used as appropriate. (The applicable column of Table 1 is referenced in the subsequent Tasks 12 through 15.) Table 1. Anticipated Sheet Counts by Design Level. Anticipated Drawings Anticipated Sheet Count Design Level (Task): 30% (Task 12) 60% (Task 13) 90%/Ad-Ready (Tasks 14, 15) Cover sheet, index, and vicinity map 1 1 1 Legend and abbreviations 1 1 1 Construction alignment and survey control plan 1 1 1 Site preparation and TESC plan 3 3 3 Typical roadway sections 1 1 1 Roadway profiles 1 1 1 Roadway plan 3 3 3 Intersection plan - 4 4 Roadway details - 2 2 Drainage plan 3 3 3 Drainage profiles and details - 3 3 Water plan 3 3 3 Water profiles and details - 2 2 Illumination and electrical plan and details 3 3 5 Channelization and signing plan 3 3 3 Channelization and signing details - 1 1 Construction sequencing plan 2 2 2 Temporary traffic signal plan - 1 2 Traffic control plan (incl. detour plan, if used) 5 10 10 Design Level (Task): 30% (Task 11) 60% (Task 11) 90%/Ad-Ready (Task 11) Landscaping plan - 3 3 Landscaping details - 2 2 Irrigation plan - 3 3 COML Council Packet 11-14-23, Page 213 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 28 Anticipated Drawings Anticipated Sheet Count Design Level (Task): 30% (Task 12) 60% (Task 13) 90%/Ad-Ready (Tasks 14, 15) Irrigation details - 2 2 Total 30 58 61 The Consultant will show all existing utility features in halftone (screened) on all applicable plan sheets listed above. Prior to delivery to the City, the Consultant will complete a QA/QC review of the plans, specifications (if applicable), and opinion of cost deliverables in Task 12 through 15. The QA/QC review will be completed by a qualified senior engineer employed by the Consultant. In providing opinions of probable construction cost, the City understands that the Consultant has no control over the cost or availability of labor, equipment, or materials, or over market conditions or the Contractor’s method of pricing, and that the Consultant’s opinions of probable construction costs are made on the basis of the Consultant’s professional judgment and experience. The Consultant makes no warranty, express or implied, that the bids or the negotiated cost of the Work will not vary from the Consultant’s opinion of probable construction cost. Task 12 – 30% Design The Consultant will prepare 30% design level construction plans and opinion of costs and submit them to the City for review and comment. 12.1 Plans The Consultant will prepare anticipated plans for the final construction documents to a 30% level of detail. See the “Task 12” column of Table 1 for the anticipated sheet list for 30% design. Within this 30% design task, the Consultant will develop the footprint for the intersection improvements, including the shape and size of roundabout central island, splitter islands, crosswalk locations, curb ramp locations, and landscaping areas. In developing these elements, the Consultant will complete the following analyses for the roundabout: fastest path evaluations, sight distance triangles, and turn simulations for vehicles to be designed for and accommodated. The Consultant will attempt to reduce the footprint of paved improvements (up to and including the back of sidewalk) with a specific focus on avoiding right-of-way (ROW) acquisition or temporary construction easement (TCE) needs. If the Consultant identifies that ROW acquisition and/or TCEs are required to complete the project, the Consultant will identify the areas and affected properties within this task. In developing the illumination and electrical plans, the Consultant will model illumination levels at the intersection using AGi32 software to determine what combination of new and existing luminaires is required to meet lighting standards on the state route. Traffic Control Analysis The Consultant will coordinate with the City and WSDOT to identify the recommended traffic control approach for the 30% submittal. The Consultant will prepare an evaluation memorandum summarizing available traffic control methods and the anticipated (qualitative) impacts to local drivers, regional drivers, COML Council Packet 11-14-23, Page 214 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 29 and nearby commercial parcels. This memorandum will discuss methods such as partial intersection closures, full intersection closure, night work, and other methods identified by the Consultant’s engineering and construction management staff. After developing the memorandum and collaborating with City and WSDOT staff to find the recommended treatment(s), the Consultant will reflect those recommendations in the construction sequencing and traffic control plans. The traffic control plan sheets at 30% will be schematic views of driver and pedestrian routes; details such as barrels, tapers, and signs will not be included. 12.2 Opinion of Cost The Consultant will prepare and submit to the City a 30% opinion of cost for construction based on the 30% plans. The opinion of cost will be based on unit prices and incorporate a 30% contingency to account for the level of completeness of plan preparation and to reflect past experience on similar projects within the region. Deliverables (for all Task 12 subtasks): · Traffic control assessment memorandum. · 30% plans. · 30% opinion of cost. Task 13 – 60% Design 13.1 DA Comment Resolution The Consultant will consolidate all comments provided by WSDOT on the DA documentation submittal into a comments log for tracking and comment responses. Consultant will prepare a proposed response to each comment received, and then conduct one meeting with WSDOT and City staff to reconcile any outstanding comments. The Consultant shall track all resolution and incorporation of each comment in a comment log. After resolving comments on the DA documentation, the Consultant assumes that the footprint has been vetted by both the City and by WSDOT and that no significant changes to the footprint will be requested after the 60%, 90%, PDA documentation, or ad-ready submittals. If a significant footprint change is requested at any of those submittals, it shall require an amendment to this Scope of Services to complete. 13.2 Plans The Consultant will prepare anticipated plans for the final construction documents to a 30% level of detail. See the “Task 12” column of Table 1 for the anticipated sheet list for 30% design. The Consultant will complete the following new tasks to develop the sheets listed above (all design elements listed under the preliminary phase are still applicable to sheets developed under that phase): · General: incorporate comments from the 30% and DA review and comment resolution. · General: incorporate pothole data from franchise or City utilities (see Task 4). · General: show construction notes for all activities not covered by plan sheet legends. · Site preparation: evaluate best management practices (BMPs) for erosion control. COML Council Packet 11-14-23, Page 215 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 30 · Roadway paving and grading: complete an intersection grading/elevation model; refine design elements to achieve compliance with PROWAG dated July 26, 2011 standards (or MEF); adjust paving limits as necessary to achieve grading goals. · Intersections: document horizontal and vertical design data at intersections, including curb return data, curb ramp size and grading, splitter island grading, and central island grading. · Roadway details: develop non-standard design elements, including decorative paving elements for roundabout islands. · Drainage: refine design based on pothole data and utility coordination; generate profile views for proposed pipes and structures, showing existing crossing utilities for a conflict check; detail storm drainage design elements. · Water: refine design based on pothole data and utility coordination; generate profile views for proposed pipes and valves, showing existing crossing utilities for a conflict check; detail water system design elements. · Illumination, RRFBs, and temporary traffic signals: complete schedules for poles, foundations, and conduits; coordinate design with utilities; identify anticipated power source for service cabinet and begin power connection coordination. · Channelization and signing: provide full sign schedule and details for non-standard channelization and signing elements. · Traffic control: provide traffic control plans for all anticipated construction phases by illustrating lane closures, uniform police officer and/or temporary signal needs, taper locations, and barrel/device/sign locations. The 60% plans will not illustrate details such as taper lengths or number of barrels or sign spacing. Those details will be added at the 90% level (see Task 14). · Landscaping, irrigation, and urban design: see Task 11. 13.3 Specifications The Consultant will prepare full contract provisions (project manual) for the project based on English units for the 60% submittal. This will include special provisions for the items of work that are not covered by the latest WSDOT/APWA Standard Specifications. These special provisions will include WSDOT, APWA, and, if provided by the City, local agency general special provisions (GSPs) as appropriate. The City will provide a template for the project manual document, including all required bidding and contract forms that the Consultant will modify with project-specific information. 13.4 Opinion of Cost The Consultant will prepare and submit to the City a 60% opinion of cost for construction based on the 60% plans. The opinion of cost will be based on unit prices and incorporate contingencies to account for the 60% level of completeness, and to reflect past experience on similar projects within the region. When preparing the opinion of cost, the Consultant will endeavor to keep the project within the construction cost identified in the 30% opinion of cost. If the Consultant discovers that likely construction costs have increased from the 30% opinion of cost, the Consultant will make suggestions on how to bring the project back within budget. Deliverables (for all Task 13 subtasks): · Completed comment log from the DA documentation submittal. COML Council Packet 11-14-23, Page 216 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 31 · DA comment resolution meeting agenda and notes. · 60% plans. · 60% project manual, including specifications. · 60% opinion of cost. Task 14 – 90% Design 14.1 60% Comment Resolution The Consultant will consolidate all comments provided by City on the 60% design submittal into a comments log for tracking and comment responses. Consultant will prepare a proposed response to each comment received, and then conduct one virtual meeting with City staff (and WSDOT if necessary) to reconcile any outstanding comments. The Consultant shall track all resolution and incorporation of each comment in a comment log. 14.2 Plans The Consultant will prepare anticipated plans for the final construction documents to a 90% level of detail. The Consultant anticipates that the 90% design will include all sheets for the final construction document package to be used by the contractor. See the “Tasks 14, 15” column of Table 1 for the anticipated sheet list. The Consultant will complete the following new tasks to develop the sheets listed above (all design elements listed under the prior design phases are still applicable to sheets developed under that phase): · General: incorporate comments from the 60% review and comment resolution. · General: coordinate elements for consistency with the project specifications. · General: provide full listing of station, offset, and elevation data for construction activities. · General: review project constructability and revise design elements as necessary. This includes Consultant completing a site visit to compare the proposed design and proposed removals to the existing conditions. · Roadway paving and grading: finalize grading/elevation model. · Illumination, RRFBs, and temporary traffic signals: provide one-line/wiring diagram and power connection details. · Traffic control: detail all plan elements including dimensions of tapers and sign spacing. · Landscaping, irrigation, and urban design: see Task 11. 14.3 Specifications The Consultant will revise the 60% contract provisions based on comments received from the City to produce a 90% project manual. If WSDOT has issued a new yearly iteration of the Standard Specifications, the Consultant will revise the project manual to use the latest year available. Similarly, the Consultant will incorporate any revised GSPs since the 60% submittal. 14.4 Opinion of Cost The Consultant will prepare and submit to the City a 90% opinion of cost for construction based on the 90% plans. The opinion of cost will be based on unit prices and incorporate contingencies to account for the 90% COML Council Packet 11-14-23, Page 217 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 32 level of completeness, and to reflect past experience on similar projects within the region. When preparing the opinion of cost, the Consultant will endeavor to keep the project within the construction cost identified in the 60% opinion of cost. If the Consultant discovers that likely construction costs have increased from the 60% opinion of cost, the Consultant will make suggestions on how to bring the project back within budget. If the Opinion of Cost includes the bid item “lump sum traffic control”, the Consultant will prepare a Lump Sum Traffic Control justification as part of the Opinion of Cost. Deliverables (for all Task 14 subtasks): · Completed comment log from the 60% design submittal. · Comment resolution meeting agenda and notes. · 90% plans. · 90% project manual, including specifications (submitted in MS Word format for WSDOT review and comment). · 90% opinion of cost. · Lump sum traffic control justification (MS Excel). · Liquidated damages calculation (MS Excel). Task 15 – Ad-Ready Design WSDOT Local Programs shall review the ad-ready design set before approval to advertise. 15.1 PDA Comment Resolution The Consultant will consolidate all comments provided by WSDOT on the PDA documentation submittal into a comments log for tracking and comment responses. Consultant will prepare a proposed response to each comment received, and then conduct one virtual meeting with WSDOT and City staff to reconcile any outstanding comments. The Consultant shall track all resolution and incorporation of each comment in a comment log. 15.2 Plans The Consultant will prepare anticipated plans for the final construction documents to an ad-ready (100%) level of detail. The Consultant anticipates that the ad-ready design will include all sheets for the final construction document package to be used by the contractor (see the “90%/Ad-Ready” column in Table 1). The Consultant will complete the following new tasks to develop the sheets listed above (all design elements listed under the prior design phases are still applicable to sheets developed under that phase): · General: incorporate comments from the 90% design/PDA documentation review and comment resolution. · General: incorporate changes as necessary due to utility or developer coordination activities. · General: designate all sheets as construction-ready through signatures by each engineer or record. 15.3 Specifications The Consultant will revise the 90% contract provisions based on comments received from the City to produce an COML Council Packet 11-14-23, Page 218 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 33 ad-ready (100%) project manual. If WSDOT has issued a new yearly iteration of the Standard Specifications, the Consultant will revise the project manual to use the latest year available. Similarly, the Consultant will incorporate any revised GSPs since the 60% submittal. The Consultant’s engineer of record shall sign the construction-ready contract provisions. 15.4 Opinion of Cost The Consultant will prepare and submit to the City a final opinion of cost for construction based on the ad- ready plans. The opinion of cost will be based on unit prices and incorporate no contingency to account for the 100% level of completeness, and to reflect past experience on similar projects within the region. When preparing the opinion of cost, the Consultant will endeavor to keep the project within the construction cost identified in the 90% opinion of cost prepared by the Consultant during an earlier phase of work. If the Consultant discovers that likely construction costs have increased from the 90% opinion of cost, the Consultant will make suggestions on how to bring the project back within budget. Deliverables (for all Task 15 subtasks): · Completed comment log from the PDA documentation submittal. · Comment resolution meeting agenda and notes. · Ad-ready plans, stamped and signed by a licensed Washington State professional engineer. · Ad-ready project manual, including specifications, stamped and signed by a licensed Washington State professional engineer. · Final opinion of cost. Task 16 – Bid Support The Consultant will support the City during the bidding phase of the project. The Consultant will respond to requests for clarifications and prepare Addendums. Consultant staff time for this task shall be limited to 36 hours. Time in excess of that maximum shall require an amendment. Bid Clarifications The Consultant will respond to Contractor questions as requested by the City during the bidding process. The Consultant will provide clarifications to the City, which may include plan sheet revisions, special provision language, or information clarification. Addenda The Consultant will assist the City with preparing materials to be included with up to two addenda, as required. Addenda will be reviewed and approved by WSDOT Local Programs. Assumptions: · The City will prepare addendums for distribution during the bidding process. · The City will prepare the bid tabulation. · The City will determine if the bids are responsive or not. · The City will track bid questions and communicate with bidders. · The City will produce bid sets. COML Council Packet 11-14-23, Page 219 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 34 · The City will review bid tabulations against the opinion of cost (engineer’s estimate). · The budget assigned for this work element will be limited to the amount designated for this work element. Conformed Construction Documents The Consultant will modify the original bid documents to include any addendums and then reissue both the Contract Plans and Contract Provisions as a set of Conformed Construction Documents for use during construction. Also included in the Conformed Construction Documents will be copies of the bid proposal for the Contractor who is awarded the project. Deliverables: · Written clarifications to bid questions, including text and plan sheet revisions if applicable (email format) · Materials to be included with addenda, as requested, for up to two addenda · Five copies of the Conformed Construction Plans (half-size) and Conformed Project Manual submitted in hard copy form and delivered by US Mail to the City. One hard copy original of the Conformed Construction plans (full-size) and Conformed Project Manual for reproduction by the City for construction purposes, delivered by US Mail to the City. Additional (Optional) Services The Consultant may provide additional services as directed by the City which are not identified in this Scope of Services. Additional services shall not commence without written authorization and approval from the City and a supplement to the contract. Services Not Included in this Scope of Services 1. Utility potholing. 2. Design services during construction. 3. Construction management services. Items to be Furnished by the City Information Provided by Others: The City shall furnish, at the City’s expense, all information, requirements, reports, data, surveys and instructions required by this Agreement. The Consultant may use such information, requirements, reports, data, surveys, and instructions in performing its services and is entitled to rely upon the accuracy and completeness thereof. Further, the City agrees that the Consultant shall have no responsibility for any portion of the Project designed by other consultants engaged by the City. The City shall furnish the following: 1. Existing topographic survey for the project area. 2. All available “As-Built” information, including for the existing traffic signal and illumination systems. 3. Latest proposed development plans for the parcel northeast of the intersection. 4. Traffic data from citywide travel demand model (if available). COML Council Packet 11-14-23, Page 220 of 277 CITY OF MOSES LAKE SR 17/YONEZAWA BOULEVARD INTERSECTION IMPROVEMENTS Agreement with Perteet Inc. November 1, 2023 35 5. Updated underground utility information relative to the City owned utilities. 6. Any applicable preliminary design reports, geotechnical reports, and environmental reports. 7. Current City of Moses Lake general special provisions. 8. Current City of Moses Lake contract (project manual) forms and template. 9. Title reports for four adjacent parcels: Grant County parcel numbers 091356290, 091356292, 091356230, and 110075002. Design Criteria As of the date this Agreement is signed, design file, reports, documents, and plans prepared as part of this Scope of Services, to the extent feasible, will be developed in accordance with the latest edition and amendments to the following documents: 1. Design Manual (M22-10), current version at the time of DA/PDA approvals, published by WSDOT 2. Standard Specifications for Road, Bridge, and Municipal Construction, current version, published by WSDOT and the Washington State Chapter APWA 3. Standard Plans for Road, Bridge, and Municipal Construction (M 21-10), published by WSDOT 4. “Local Agency Guidelines” published by WSDOT 5. AASHTO: A Policy on Geometric Design of Highways and Streets (2018 Edition) 6. 2009 Manual on Uniform Traffic Control Devices with Washington State amendments (MUTCD) 7. Department of Ecology 2019 “Stormwater Management Manual for Eastern Washington” (SWMMEW). 8. WSDOT Plans Preparation Manual M 22-31. Changes in any design standards or requirements after services have begun may result in extra work and require a supplement to the Agreement. COML Council Packet 11-14-23, Page 221 of 277 Federal Aid Number STBGUS-017(057) Project Title SR 17/Yonezawa Boulevard Intersection Improvements Subconsultant Services to be Provided Subcontract Amount For DBE Credit Estimated Percentange of Contract OverSite, LLC Survey 23,599.00$ 23,599.00$ 3.68% HWA GeoSciences, Inc.Geotechnical 59,243.00$ 43,543.00$ 6.80% Hough Beck & Baird, Inc.Landscape and Urban Design 36,782.00$ 36,782.00$ 5.74% Michael Minor & Associates, Inc.Noise Analysis 2,016.00$ 2,016.00$ 0.31% Total 121,640.00$ 105,940.00$ 16.53% Total Contract Amount 640,723.00$ Mandatory DBE Goal 13% DBE Participation Plan COML Council Packet 11-14-23, Page 222 of 277 Exhibit C Preparation and Delivery of Electronic Engineering and Other Data In this Exhibit the agency, as applicable, is to provide a description of the format and standards the consultant is to use in preparing electronic files for transmission to the agency. The format and standards to be provided may include, but are not limited to, the following: I.Surveying, Roadway Design & Plans Preparation Section A.Survey Data B.Roadway Design Files C.Computer Aided Drafting Files Agreement Number: Exhibit C - Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 Page 1 of 4 COML Council Packet 11-14-23, Page 223 of 277 D.Specify the Agency’s Right to Review Product with the Consultant E.Specify the Electronic Deliverables to Be Provided to the Agency F.Specify What Agency Furnished Services and Information Is to Be Provided Agreement Number: Exhibit C - Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 Page 2 of 4 COML Council Packet 11-14-23, Page 224 of 277 II.Any Other Electronic Files to Be Provided III.Methods to Electronically Exchange Data Exhibit C - Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 Page 3 of 4 COML Council Packet 11-14-23, Page 225 of 277 A.Agency Software Suite B.Electronic Messaging System C.File Transfers Format Exhibit C - Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 Page 4 of 4 COML Council Packet 11-14-23, Page 226 of 277 Exhibit D Prime Consultant Cost Computations Agreement Number: Exhibit D - Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 Page 1 of 1 COML Council Packet 11-14-23, Page 227 of 277 Consultant Fee Determination Summary Project: Yonezawa Roundabout PS&E Client: City of Moses Lake Hourly Costs Plus Fixed Fee Estimate Classification Hours Rate Amount Principal 4.00 129.81 $519 Director 110.00 93.01 $10,231 Sr. Associate 65.00 85.00 $5,525 Sr. Engineer / Mgr 260.00 69.00 $17,940 Lead Engineer / Mgr 138.00 60.10 $8,294 Engineer III 650.00 49.00 $31,850 Civil Designer II 978.00 44.10 $43,130 Lead Technician/Designer 640.00 43.50 $27,840 Technician I 6.00 28.00 $168 Sr Planner/Cultural Resources Manager 42.00 56.72 $2,382 Planner III 100.00 50.94 $5,094 Lead Environmental Scientist/Manager 24.00 54.60 $1,310 Senior Construction Manager 16.00 72.00 $1,152 Accountant 20.00 54.83 $1,097 Clerical 23.00 35.55 $818 Mkt Proposal Mgr 10.00 45.00 $450 Cultural Resources Specialist II 61.00 41.57 $2,536 Cultural Resources Specialist I 6.00 31.50 $189 Total Direct Salary Costs 3,153.00 $160,525 Overhead @ 188.43% $302,477 Fixed Fee @ 30.00% $48,157 Total Labor Costs $511,159 Reimbursables Expenses Amount Printing $1,000.00 Travel – Allowable $800.00 Total Expenses $1,800.00 In-House Costs Qty Rate Amount Mileage - $.655 3,420 $0.655 $2,240.00 Total In-House Costs $2,240.00 Subconsultants Subconsultants Cost Markup Amount Commonstreet Consulting, LLC $3,884.00 1.00 $3,884.00 Hough Beck & Baird, Inc. $36,782.00 1.00 $36,782.00 HWA GeoSciences Inc $59,243.00 1.00 $59,243.00 Michael Minor & Associates, Inc. $2,016.00 1.00 $2,016.00 OverSite LLC $23,599.00 1.00 $23,599.00 Total Subconsultants $125,524.00 $125,524.00 CONTRACT TOTAL $640,723.00 Rates shown reflect the typical compensation rate of employees assigned to the billing category listed. Each category may have multiple employees assigned to that billing category and each employee may have a different hourly rate of pay. Employee compensation is subject to adjustment in June of each calendar year. Prepared By: Brent M Powell Date: November 1, 2023 EXHIBIT D COML Council Packet 11-14-23, Page 228 of 277 August 30, 2023 Perteet, Inc. 2707 Colby Avenue, Suite 900 Everett, WA 98201 Subject: Acceptance FYE 2022 ICR – CPA Report Dear Denice M. Moan: We have accepted your firms FYE 2022 Indirect Cost Rate (ICR) of 188.43% of direct labor (rate includes 0.23% Facilities Capital Cost of Money) based on the “Independent CPA Report,” prepared by Stambaugh Ness. This rate will be applicable for WSDOT Agreements and Local Agency Contracts in Washington only. This rate may be subject to additional review if considered necessary by WSDOT. Your ICR must be updated on an annual basis. Costs billed to agreements/contracts will still be subject to audit of actual costs, based on the terms and conditions of the respective agreement/contract. This was not a cognizant review. Any other entity contracting with the firm is responsible for determining the acceptability of the ICR. If you have any questions, feel free to contact our office at (360) 704-6397 or via email consultantrates@wsdot.wa.gov. Regards, SCHATZIE HARVEY, CPA Contract Services Manager SH:leg COML Council Packet 11-14-23, Page 229 of 277 Exhibit E Sub-consultant Cost Computations The CONSULTANT shall not sub-contract for the performance of any work under this AGREEMENT without prior written permission of the AGENCY. Refer to section VI “Sub-Contracting” of this AGREEMENT. The following subconsultants will provide services under this AGREEMENT: Exhibit E-1 Commonstreet Consulting, LLCExhibit E-2 Hough Beck & Baird, Inc.Exhibit E-3 HWA GeoSciences, Inc.Exhibit E-4 Michael Minor & Associates, Inc.Exhibit E-5 OverSite, LLC Agreement Number: Exhibit E - Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 Page 1 of 1 COML Council Packet 11-14-23, Page 230 of 277 Exhibit E-1 - Subconsultant Fee Determination Summary Sheet Subconsultant: Commonstreet Consulting, LLC Project: SR 17 and Yonezawa Boulevard Intersection Improvements Client: City of Moses Lake DIRECT SALARY RATES Classification Hours Rate Cost Project Manager 8 x $70.90 =$567 Right of Way Agent 28 x $39.38 =$1,103 Right of Way Technician 0 x $50.00 =$0 Project Control Specialist 0 x $38.47 =$0 Direct Salary Costs =$1,670 DSC X Overhead (102.57%)=$1,713 DSC X Fee (30%)=$501 TOTAL DIRECT SALARY X OH AND FF =$3,884 REIMBURSABLES Mileage $0 Appraisal $0 Mailings $0 TOTAL REIMBURSABLE COST =-$ CONTRACT TOTAL =$3,884 Prepared By : Morgan Bishop, PM Y:\Contract Administration\Contracts - Working File\Moses Lake\20220146_Yonezawa Blvd Roundabout\Commonstreet\[20220146_Sub_Fee_CPFF_2023_Commonstreet.xlsx]Subconsultant Fee Determination Page 1 @ $0.655/mile rate COML Council Packet 11-14-23, Page 231 of 277 March 24, 2023 Commonstreet Consulting, LLC 100 S King Street, Ste. 100 Seattle, WA 98104 Subject: Acceptance FYE 2022 ICR Risk Assessment Review Dear Kelly Skove: Assessment review of your Indirect Cost Rate (ICR), we have accepted your proposed FYE 2022 ICR of 102.57%. This rate will be applicable for WSDOT Agreements and Local Agency Contracts in Washington only. This rate may be subject to additional review if considered necessary by WSDOT. Your ICR must be updated on an annual basis. Costs billed to agreements/contracts will still be subject to audit of actual costs, based on the terms and conditions of the respective agreement/contract. This was not a cognizant review. Any other entity contracting with your firm is responsible for determining the acceptability of the ICR. If you have any questions, feel free to contact our office at (360) 705-7019 or via email consultantrates@wsdot.wa.gov. Regards; SCHATZIE HARVEY, CPA Contract Services Manager SH:ah COML Council Packet 11-14-23, Page 232 of 277 Exhibit E-2 Subconsultant Fee Determination Summary Sheet Subconsultant: Hough Beck & Baird Inc. (HBB) Project: SR 17 and Yonezawa Boulevard Intersection Improvements Client: City of Moses Lake DIRECT SALARY RATES Classification Hours Rate Cost Principal 20 x $82.00 =$1,640 Project Manager 45 x $70.00 =$3,150 Design Staff 57 x $49.00 =$2,793 Computer Tech 158 x $36.00 =$5,688 Business Management 12 x $61.00 =$732 Clerical/Administration 0 x $39.00 =$0 Direct Salary Costs =$14,003 DSC X Overhead (132.67%)=$18,578 DSC X Fee (30%)=$4,201 TOTAL DIRECT SALARY X OH AND FF =$36,782 REIMBURSABLES Mileage $0 Xerox Copies $0 TOTAL REIMBURSABLE COST =-$ CONTRACT TOTAL =$36,782 Prepared By : Aaron Luoma, ASLA Date: 11/1/2023 C:\Users\janice.kramer\Downloads\[20220146_Sub_Fee_CPFF_2023_HBB.xlsx]Subconsultant Fee Determination Page 1 COML Council Packet 11-14-23, Page 233 of 277 July 6, 2023 Hough Beck & Baird, Inc. 2101 4th Avenue, Suite 1800 Seattle, WA 98121 Subject: Acceptance FYE 2022 ICR – Risk Assessment Review Dear Pam Neuman: Based on Washington State Department of Transportation’s (WSDOT) Risk Assessment review of your Indirect Cost Rate (ICR), we have accepted your proposed FYE 2022 ICR of 132.67%. This rate will be applicable for WSDOT Agreements and Local Agency Contracts in Washington only. This rate may be subject to additional review if considered necessary by WSDOT. Your ICR must be updated on an annual basis. Costs billed to agreements/contracts will still be subject to audit of actual costs, based on the terms and conditions of the respective agreement/contract. This was not a cognizant review. Any other entity contracting with your firm is responsible for determining the acceptability of the ICR. If you have any questions, feel free to contact our office at (360) 704-6397 or via email consultantrates@wsdot.wa.gov. Regards; SCHATZIE HARVEY, CPA Contract Services Manager SH:BJO COML Council Packet 11-14-23, Page 234 of 277 Exhibit E-3 - Subconsultant Fee Determination Summary Sheet Subconsultant: HWA GeoSciences Project: SR 17 and Yonezawa Boulevard Intersection Improvements Client: City of Moses Lake DIRECT SALARY RATES Classification Hours Rate Cost Geologist VIII 3 x $85.00 x $255 Geotechnical Engineer VIII 0 x $87.50 x $0 Geotechnical Engineer VIII 35 x $87.50 x $3,063 Geotechnical Engineer V 82 x $58.50 x $4,797 Geotechnical Engineer II 73 x $46.00 x $3,358 Geologist IV 0 x $46.00 x $0 CAD 10 x $32.50 x $325 Contracts Administrator 9 x $45.00 x $405 Administrative Support 2 x $33.00 x $66 Direct Salary Costs =$12,269 DSC X Overhead (190.07%)=$23,319 DSC X Fee (30%)=$3,681 TOTAL DIRECT SALARY X OH AND FF =$39,268 REIMBURSABLES $997 $288 $236 $8,900 $5,500 $1,300 $600 Mileage @ $0.655/mile rate(5 visits) Per Diem Lodging ($96/night) Per Diem Meals & Incidentals ($59/day) Drilling Subconrtactor Excavator and Water Tank Subcontractor Flaggers and Traffic Control Rental Transducer Rental (1 year) Laboratory Testing $2,154 TOTAL REIMBURSABLE COST = 19,975.12$ CONTRACT TOTAL =$59,243 Prepared By : Ali Sirjani Date: 9/5/2023 Y:\Contract Administration\Contracts - Working File\Moses Lake\20220146_Yonezawa Blvd Roundabout\HWA\[20220146_Sub_Fee_CPFF_2023_HWA.xlsx]Subconsultant Fee Determination Page 1 COML Council Packet 11-14-23, Page 235 of 277 COML Council Packet 11-14-23, Page 236 of 277 Exhibit E-4 -Subconsultant Fee Determination Summary Sheet Subconsultant: Michael Minor & Associates, Inc. Project: SR 17 and Yonezawa Boulevard Intersection Improvements Client: City of Moses Lake DIRECT SALARY RATES Classification Hours Rate Cost Principal 4 x $75.00 =$300 Noise Analyst 14 x $37.00 =$518 Direct Salary Costs =$818 DSC X Overhead (116.47%)=$953 DSC X Fee (30%)=$245 TOTAL DIRECT SALARY X OH AND FF =$2,016 REIMBURSABLES Mileage $0 Xerox Copies $0 TOTAL REIMBURSABLE COST =-$ CONTRACT TOTAL =$2,016 Prepared By : Michael Minor Y:\Contract Administration\Contracts - Working File\Moses Lake\20220146_Yonezawa Blvd Roundabout\MM&A\[20220146_Sub_Fee_CPFF_2023_MM&A.xlsx]Subconsultant Fee Determination Page 1 @ $0.655/mile rate COML Council Packet 11-14-23, Page 237 of 277 July 20, 2023 Michael Minor & Associates, Inc. 4923 SE 36th Ave Portland, OR 97202 Subject: Acceptance FYE 2022 ICR – Risk Assessment Review Dear Michael Minor: Based on Washington State Department of Transportation’s (WSDOT) Risk Assessment review of your Indirect Cost Rate (ICR), we have accepted your proposed FYE 2022 ICR of 116.47%. This rate will be applicable for WSDOT Agreements and Local Agency Contracts in Washington only. This rate may be subject to additional review if considered necessary by WSDOT. Your ICR must be updated on an annual basis. Costs billed to agreements/contracts will still be subject to audit of actual costs, based on the terms and conditions of the respective agreement/contract. This was not a cognizant review. Any other entity contracting with your firm is responsible for determining the acceptability of the ICR. If you have any questions, feel free to contact our office at (360) 704-6397 or via email consultantrates@wsdot.wa.gov. Regards; SCHATZIE HARVEY, CPA Contract Services Manager SH:BJO COML Council Packet 11-14-23, Page 238 of 277 Exhibit E-5 - Subconsultant Fee Determination Summary Sheet Subconsultant: OverSite LLC Project: SR 17 and Yonezawa Boulevard Intersection Improvements Client: City of Moses Lake DIRECT SALARY RATES Classification Hours Rate Cost PLS/Owner 74 x $77.08 =$5,704 Senior Technician 60 x $30.00 =$1,800 Party Chief 60 x $35.00 =$2,100 Direct Salary Costs =$9,604 DSC X Overhead (110.00%)=$10,564 DSC X Fee (30%)=$2,881 TOTAL DIRECT SALARY X OH AND FF =$23,049 REIMBURSABLES Mileage $550 TOTAL REIMBURSABLE COST = 550.00$ CONTRACT TOTAL =$23,599 Prepared By : Joshua Velazquez, PLS Y:\Contract Administration\Contracts - Working File\Moses Lake\20220146_Yonezawa Blvd Roundabout\Oversite\[20220146_Sub_Fee_CPFF_2023_Oversite.xlsx]Subconsultant Fee Determination Page 1 @ $0.655/mile rate COML Council Packet 11-14-23, Page 239 of 277 February 9, 2022 Joshua Velazquez, Owner OverSite, LLC 6 1st Street Wenatchee, WA 98801-2247 •Re: OverSite, LLCSafe Harbor Indirect Cost Rate Dear Mr. Velazquez: Washington State has received approval from our local Federal Highway Administration (FHWA) Division to continue administering the “safe harbor” indirect cost rate program on engineering and design related service contracts, as well as for Local Public Agency projects. We have completed our risk assessment for OverSite, LLC. We conducted our assessment based on the documentation provided by the firm. The reviewed data included, but was not limited to, a description of the company, basis of accounting, accounting system and the basis of indirect costs. Based on our review, your firm is eligible to use the Safe Harbor rate. You have opted to use the Safe Harbor rate, rather than provide a FAR-compliant rate at this time. We are issuing the Safe Harbor Indirect Cost Rate of 110% of direct labor with a field rate, where applicable, of 80% of direct labor for OverSite. The Safe Harbor rate is effective on February 9, 2022. OverSite has agreed to improve Internal Controls and timekeeping processes to be able to develop an Indirect Cost Rate Schedule in the future in accordance with the Federal Acquisition Regulations (FAR), Subpart 31. The WSDOT Internal Audit Office has provided guidance and information related to FARs and the AASHTO Audit Guide. You may use the Safe Harbor Rate of 110%, or 80% for field office situations, for agreements entered prior to February 9, 2025. For agreements entered after this date, please contact the WSDOT Consultant Services Office (CSO) or our office for guidance. The Safe Harbor Rate will not be subject to audit. Please coordinate with CSO or your Local Programs contact if you have questions about when to apply the Safe Harbor rate to your agreement. If you have any questions, please contact Steve McKerney or me at (360)705-7003. Sincerely, Schatzie Harvey, CPA Agreement Compliance Audit Manager cc: Steve McKerney, Director of Internal Audit Larry Schofield, MS 47323 File COML Council Packet 11-14-23, Page 240 of 277 Agreement Number ____________ Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 Exhibit F - Title VI Assurances Appendix A & E APPENDIX ADuring the performance of this contract, the contractor, for itself, its assignees, and successors in interest (hereinafter referred to as the "contractor") agrees as follows: 1.Compliance with Regulations: The contractor (hereinafter includes consultants) will comply with the Acts and the Regulations relative to Non-discrimination in Federally-assisted programs of the U.S. Department ofTransportation, (Title of Modal Operating Administration), as they may be amended from time to time, whichare herein incorporated by reference and made a part of this contract. 2.Non-discrimination: The contractor, with regard to the work performed by it during the contract, will notdiscriminate on the grounds of race, color, or national origin in the selection and retention of subcontractors,including procurements of materials and leases of equipment. The contractor will not participate directly orindirectly in the discrimination prohibited by the Acts and the Regulations, including employment practices when the contract covers any activity, project, or program set forth in Appendix B of 49 CFR Part 21. [Include Modal Operating Administration specific program requirements.] 3.Solicitations for Subcontracts, Including Procurements of Materials and Equipment: In all solicitations, either by competitive bidding, or negotiation made by the contractor for work to be performed under a subcontract, including procurements of materials, or leases of equipment, each potential subcontractor orsupplier will be notified by the contractor of the contractor's obligations under this contract and the Acts andthe Regulations relative to Non-discrimination on the grounds of race, color, or national origin. [IncludeModal Operating Administration specific program requirements.] 4.Information and Reports: The contractor will provide all information and reports required by the Acts, theRegulations, and directives issued pursuant thereto and will permit access to its books, records, accounts, othersources of information, and its facilities as may be determined by the Recipient or the (Title of Modal Operating Administration) to be pertinent to ascertain compliance with such Acts, Regulations, and instructions. Where any information required of a contractor is in the exclusive possession of another who fails or refuses to furnish the information, the contractor will so certify to the Recipient or the (Title of Modal Operating Administration), as appropriate, and will set forth what efforts it has made to obtain the information. 5.Sanctions for Noncompliance: In the event of a contractor's noncompliance with the Non- discriminationprovisions of this contract, the Recipient will impose such contract sanctions as it or the (Title of ModalOperating Administration) may determine to be appropriate, including, but not limited to: a.withholding payments to the contractor under the contract until the contractor complies; and/orb.cancelling, terminating, or suspending a contract, in whole or in part. 6.Incorporation of Provisions: The contractor will include the provisions of paragraphs one through six in every subcontract, including procurements of materials and leases of equipment, unless exempt by the Acts, the Regulations and directives issued pursuant thereto. The contractor will take action with respect to any subcontract or procurement as the Recipient or the (Title of Modal Operating Administration) may direct as a means of enforcing such provisions including sanctions for noncompliance. Provided, that if the contractor becomes involved in, or is threatened with litigation by a subcontractor, or supplier because of such direction,the contractor may request the Recipient to enter into any litigation to protect the interests of the Recipient. Inaddition, the contractor may request the United States to enter into the litigation to protect the interests of theUnited States. COML Council Packet 11-14-23, Page 241 of 277 Local Agency A&E Professional Services Agreement Number ____________ Negotiated Hourly Rate Consultant Agreement Revised 02/01/2021 Exhibit F - Title VI Assurances Appendix A & E APPENDIX E During the performance of this contract, the contractor, for itself, its assignees, and successors in interest (hereinafter referred to as the "contractor") agrees to comply with the following non-discrimination statutes and authorities; including but not limited to: Pertinent Non-Discrimination Authorities: •Title VI of the Civil Rights Act of 1964 (42 U.S.C. § 2000d et seq., 78 stat. 252), (prohibitsdiscrimination on the basis of race, color, national origin); and 49 CFR Part 21. •The Uniform Relocation Assistance and Real Property Acquisition Policies Act of 1970, (42 U.S.C. §4601), (prohibits unfair treatment of persons displaced or whose property has been acquired because ofFederal or Federal-aid programs and projects); •Federal-Aid Highway Act of 1973, (23 U.S.C. § 324 et seq.), (prohibits discrimination on the basis ofsex);•Section 504 of the Rehabilitation Act of 1973, (29 U.S.C. § 794 et seq.), as amended, (prohibits discrimination on the basis of disability); and 49 CFR Part 27; •The Age Discrimination Act of 1975, as amended, (42 U.S.C. § 6101 et seq.), (prohibits discrimination on the basis of age); •Airport and Airway Improvement Act of 1982, (49 USC § 471, Section 47123), as amended, (prohibits discrimination based on race, creed, color, national origin, or sex); •The Civil Rights Restoration Act of 1987, (PL 100-209), (Broadened the scope, coverage andapplicability of Title VI of the Civil Rights Act of 1964, The Age Discrimination Act of 1975 andSection 504 of the Rehabilitation Act of 1973, by expanding the definition of the terms "programs oractivities" to include all of the programs or activities of the Federal-aid recipients, sub-recipients andcontractors, whether such programs or activities are Federally funded or not);•Titles II and III of the Americans with Disabilities Act, which prohibit discrimination on the basis ofdisability in the operation of public entities, public and private transportation systems, places of publicaccommodation, and certain testing entities (42 U.S.C. §§ 12131-12189) as implemented by Department of Transportation regulations at 49 C.F.R. parts 37 and 38; •The Federal Aviation Administration's Non-discrimination statute (49 U.S.C. § 47123) (prohibits discrimination on the basis of race, color, national origin, and sex); •Executive Order 12898, Federal Actions to Address Environmental Justice in Minority Populations and Low-Income Populations, which ensures discrimination against minority populations by discouragingprograms, policies, and activities with disproportionately high and adverse human health orenvironmental effects on minority and low-income populations; •Executive Order 13166, Improving Access to Services for Persons with Limited English Proficiency,and resulting agency guidance, national origin discrimination includes discrimination because of limitedEnglish proficiency (LEP). To ensure compliance with Title VI, you must take reasonable steps toensure that LEP persons have meaningful access to your programs (70 Fed. Reg. at 74087 to 74100);•Title IX of the Education Amendments of 1972, as amended, which prohibits you from discriminating because of sex in education programs or activities (20 U.S.C. 1681 et seq). COML Council Packet 11-14-23, Page 242 of 277 Exhibit G Certification Documents Exhibit G-1(a) Certification of Consultant Exhibit G-1(b) Certification of CITY OF MOSES LAKE Exhibit G-2 Certification Regarding Debarment, Suspension and Other Responsibility Matters -Primary Covered Transactions Exhibit G-3 Certification Regarding the Restrictions of the Use of Federal Funds for Lobbying Exhibit G-4 Certificate of Current Cost or Pricing Data Agreement Number: Exhibit G - Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 Page 1 of 1 COML Council Packet 11-14-23, Page 243 of 277      Exhibit G-1(a)  Certification of Consultant I hereby certify that I am the duly authorized representative of the firm of Perteet, Inc. whose address is 2707 Colby Ave, Suite 900, Everett, WA 98201 and that neither the above firm nor I have: a) Employed or retained for a commission, percentage, brokerage, contingent fee, or other consideration,any firm or person (other than a bona fide employee working solely for me or the above CONSULTANT)to solicit or secure this AGREEMENT; b) Agreed, as an express or implied condition for obtaining this contract, to employ or retain the services ofany firm or person in connection with carrying out this AGREEMENT; or c) Paid, or agreed to pay, to any firm, organization or person (other than a bona fide employee working solelyfor me or the above CONSULTANT) any fee, contribution, donation, or consideration of any kind for, or inconnection with, procuring or carrying out this AGREEMENT; except as hereby expressly stated (if any); I acknowledge that this certificate is to be furnished to the and the Federal Highway Administration, U.S. Department of Transportation in connection with this AGREEMENT involving participation of Federal-aid highway funds, and is subject to applicable State and Federal laws, both criminal and civil. Consultant (Firm Name) Signature (Authorized Official of Consultant) Date Agreement Number: Exhibit G - Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 COML Council Packet 11-14-23, Page 244 of 277      Exhibit G-1(b)  Certification of I hereby certify that I am the: Other of the , and or its representative has not been required, directly or indirectly as an express or implied condition in connection with obtaining or carrying out this AGREEMENT to: a) Employ or retain, or agree to employ to retain, any firm or person; or b) Pay, or agree to pay, to any firm, person, or organization, any fee, contribution, donation, or consideration of any kind; except as hereby expressly stated (if any): I acknowledge that this certificate is to be furnished to the and the Federal Highway Administration, U.S. Department of Transportation, in connection with this AGREEMENT involving participation of Federal-aid highway funds, and is subject to applicable State and Federal laws, both criminal and civil. Signature Date Agreement Number: Exhibit G - Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 COML Council Packet 11-14-23, Page 245 of 277               Exhibit G-2 Certification Regarding Debarment, Suspension and Other Responsibility Matters - Primary Covered Transactions I.The prospective primary participant certifies to the best of its knowledge and belief, that it and its principals: A.Are not presently debarred, suspended, proposed for debarment, declared ineligible, or voluntarilyexcluded from covered transactions by any Federal department or agency; B.Have not within a three (3) year period preceding this proposal been convicted of or had a civil judgmentrendered against them for commission of fraud or a criminal offense in connection with obtaining,attempting to obtain, or performing a public (Federal, State, or local) transaction or contract undera public transaction; violation of Federal or State anti-trust statues or commission of embezzlement,theft, forgery, bribery, falsification or destruction of records, making false statements, or receivingstolen property; C.Are not presently indicted for or otherwise criminally or civilly charged by a governmental entity(Federal, State, or local) with commission of any of the offenses enumerated in paragraph (1)(b)of this certification; and D.Have not within a three (3) year period preceding this application / proposal had one or more publictransactions (Federal, State and local) terminated for cause or default. II.Where the prospective primary participant is unable to certify to any of the statements in this certification,such prospective participant shall attach an explanation to this proposal. Consultant (Firm Name) Signature (Authorized Official of Consultant) Date Agreement Number: Exhibit G - Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 COML Council Packet 11-14-23, Page 246 of 277                     Exhibit G-3  Certification Regarding the Restrictions of the Use of Federal Funds for Lobbying The prospective participant certifies, by signing and submitting this bid or proposal, to the best of his or her knowledge and belief, that: 1.No Federal appropriated funds have been paid or will be paid, by or on behalf of the undersigned, to anyperson for influencing or attempting to influence an officer or employee of any Federal agency, a Memberof Congress, an officer or employee of Congress, or any employee of a Member of Congress in connectionwith the awarding of any Federal contract, the making of any Federal grant, the making of any Federal loan,the entering into of any cooperative AGREEMENT, and the extension, continuation, renewal, amendment,or modification of Federal contract, grant, loan or cooperative AGREEMENT. 2.If any funds other than Federal appropriated funds have been paid or will be paid to any person forinfluencing or attempting to influence an officer or employee of any Federal agency, a Member of Congress,an officer or employee of Congress, or an employee of a Member of Congress in connection with thisFederal contract, grant, loan or cooperative AGREEMENT, the undersigned shall complete and submitStandard Form - LLL, “Disclosure Form to Report Lobbying,” in accordance with its instructions. This certification is a material representation of fact upon which reliance was placed when this transactionwas made or entered into. Submission of this certification is a prerequisite for making or entering intothis transaction imposed by Section 1352, Title 31, U.S. Code. Any person who fails to file the requiredcertification shall be subject to a civil penalty of not less than $10,000.00, and not more than $100,000.00,for each such failure. The prospective participant also agrees by submitting his or her bid or proposal that he or she shall requirethat the language of this certification be included in all lower tier sub-contracts, which exceed $100,000,and that all such sub-recipients shall certify and disclose accordingly. Consultant (Firm Name) Signature (Authorized Official of Consultant) Date Agreement Number: Exhibit G - Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 COML Council Packet 11-14-23, Page 247 of 277              Exhibit G-4  Certificate of Current Cost or Pricing Data This is to certify that, to the best of my knowledge and belief, the cost or pricing data (as defined in section 2.101 of the Federal Acquisition Regulation (FAR) and required under FAR subsection 15.403-4) submitted, either actually or by specific identification in writing, to the Contracting Officer or to the Contracting Officer’s representative in support of * are accurate, complete, and current **as of . This certification includes the cost or pricing data supporting any advance AGREEMENT’s and forward pricing rate AGREEMENT’s between the offer or and the Government that are part of the proposal. Firm: Signature Title Date of Execution***: *Identify the proposal, quotation, request for pricing adjustment, or other submission involved, giving the appropriate identifying number (e.g. project title.) **Insert the day, month, and year, when price negotiations were concluded and price AGREEMENT was reached. ***Insert the day, month, and year, of signing, which should be as close as practicable to the date when the price negotiations were concluded and the contract price was agreed to. Agreement Number: Exhibit G - Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 COML Council Packet 11-14-23, Page 248 of 277 Exhibit H Liability Insurance Increase To Be Used Only If Insurance Requirements Are Increased The professional liability limit of the CONSULTANT to the AGENCY identified in Section XII, Legal Relations and Insurance of this Agreement is amended to $ . The CONSULTANT shall provide Professional Liability insurance with minimum per occurrence limits in the amount of $ . Such insurance coverage shall be evidenced by one of the following methods: •Certificate of Insurance. •Self-insurance through an irrevocable Letter of Credit from a qualified financial institution. Self-insurance through documentation of a separate fund established exclusively for the payment of professional liability claims, including claim amounts already reserved against the fund, safeguards established for payment from the fund, a copy of the latest annual financial statements, and disclosure of the investment portfolio for those funds. Should the minimum Professional Liability insurance limit required by the AGENCY as specified above exceed $1 million per occurrence or the value of the contract, whichever is greater, then justification shall be submitted to the Federal Highway Administration (FHWA) for approval to increase the minimum insurance limit. If FHWA approval is obtained, the AGENCY may, at its own cost, reimburse the CONSULTANT for the additional professional liability insurance required. Notes: Cost of added insurance requirements: $ .  Include all costs, fee increase, premiums.  This cost shall not be billed against an FHWA funded project. •For final contracts, include this exhibit. Agreement Number: Exhibit H - Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 Page 1 of 1 NOT USED COML Council Packet 11-14-23, Page 249 of 277 Exhibit I Alleged Consultant Design Error Procedures The purpose of this exhibit is to establish a procedure to determine if a consultant’s alleged design error is of a nature that exceeds the accepted standard of care. In addition, it will establish a uniform method for the resolution and/or cost recovery procedures in those instances where the agency believes it has suffered some material damage due to the alleged error by the consultant. Step 1 Potential Consultant Design Error(s) is Identified by Agency’s Project Manager At the first indication of potential consultant design error(s), the first step in the process is for the Agency’s project manager to notify the Director of Public Works or Agency Engineer regarding the potential design error(s). For federally funded projects, the Region Local Programs Engineer should be informed and involved in these procedures. (Note: The Director of Public Works or Agency Engineer may appoint an agency staff person other than the project manager, who has not been as directly involved in the project, to be responsible for the remaining steps in these procedures.) Step 2 Project Manager Documents the Alleged Consultant Design Error(s) After discussion of the alleged design error(s) and the magnitude of the alleged error(s), and with the Director of Public Works or Agency Engineer’s concurrence, the project manager obtains more detailed documentation than is normally required on the project. Examples include: all decisions and descriptions of work; photographs, records of labor, materials and equipment. Step 3 Contact the Consultant Regarding the Alleged Design Error(s) If it is determined that there is a need to proceed further, the next step in the process is for the project manager to contact the consultant regarding the alleged design error(s) and the magnitude of the alleged error(s). The project manager and other appropriate agency staff should represent the agency and the consultant should be represented by their project manager and any personnel (including sub-consultants) deemed appropriate for the alleged design error(s) issue. Step 4 Attempt to Resolve Alleged Design Error with Consultant After the meeting(s) with the consultant have been completed regarding the consultant’s alleged design error(s), there are three possible scenarios:  It is determined via mutual agreement that there is not a consultant design error(s). If this is the case, then the process will not proceed beyond this point.  It is determined via mutual agreement that a consultant design error(s) occurred. If this is the case, then the Director of Public Works or Agency Engineer, or their representatives, negotiate a settlement with the consultant. The settlement would be paid to the agency or the amount would be reduced from the consultant’s agreement with the agency for the services on the project in which the design error took place. The agency is to provide LP, through the Region Local Programs Engineer, a summary of the settlement for review and to make adjustments, if any, as to how the settlement affects federal reimbursements. No further action is required.  There is not a mutual agreement regarding the alleged consultant design error(s). The consultant may request that the alleged design error(s) issue be forwarded to the Director of Public Works or Agency Engineer for review. If the Director of Public Works or Agency Engineer, after review with their legal counsel, is not able to reach mutual agreement with the consultant, proceed to Step 5. Agreement Number: Exhibit I - Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 Page 1 of 2 COML Council Packet 11-14-23, Page 250 of 277 Step 5 Forward Documents to Local Programs For federally funded projects all available information, including costs, should be forwarded through the Region Local Programs Engineer to LP for their review and consultation with the FHWA. LP will meet with representatives of the agency and the consultant to review the alleged design error(s), and attempt to find a resolution to the issue. If necessary, LP will request assistance from the Attorney General’s Office for legal interpretation. LP will also identify how the alleged error(s) affects eligibility of project costs for federal reimbursement.  If mutual agreement is reached, the agency and consultant adjust the scope of work and costs to reflect the agreed upon resolution. LP, in consultation with FHWA, will identify the amount of federal participation in the agreed upon resolution of the issue.  If mutual agreement is not reached, the agency and consultant may seek settlement by arbitration or by litigation. Agreement Number: Exhibit I - Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 Page 2 of 2 COML Council Packet 11-14-23, Page 251 of 277 Exhibit J Consultant Claim Procedures The purpose of this exhibit is to describe a procedure regarding claim(s) on a consultant agreement. The following procedures should only be utilized on consultant claims greater than $1,000. If the consultant’s claim(s) are a total of $1,000 or less, it would not be cost effective to proceed through the outlined steps. It is suggested that the Director of Public Works or Agency Engineer negotiate a fair and reasonable price for the consultant’s claim(s) that total $1,000 or less. This exhibit will outline the procedures to be followed by the consultant and the agency to consider a potential claim by the consultant. Step 1 Consultant Files a Claim with the Agency Project Manager If the consultant determines that they were requested to perform additional services that were outside of the agreement’s scope of work, they may be entitled to a claim. The first step that must be completed is the request for consideration of the claim to the Agency’s project manager. The consultant’s claim must outline the following: •Summation of hours by classification for each firm that is included in the claim;  Any correspondence that directed the consultant to perform the additional work;  Timeframe of the additional work that was outside of the project scope; •Summary of direct labor dollars, overhead costs, profit and reimbursable costs associated withthe additional work; and  Explanation as to why the consultant believes the additional work was outside of the agreement scope of work. Step 2 Review by Agency Personnel Regarding the Consultant’s Claim for Additional Compensation After the consultant has completed step 1, the next step in the process is to forward the request to the Agency’s project manager. The project manager will review the consultant’s claim and will met with the Director of Public Works or Agency Engineer to determine if the Agency agrees with the claim. If the FHWA is participating in the project’s funding, forward a copy of the consultant’s claim and the Agency’s recommendation for federal participation in the claim to the WSDOT Local Programs through the Region Local Programs Engineer. If the claim is not eligible for federal participation, payment will need to be from agency funds. If the Agency project manager, Director of Public Works or Agency Engineer, WSDOT Local Programs (if applicable), and FHWA (if applicable) agree with the consultant’s claim, send a request memo, including backup documentation to the consultant to either supplement the agreement, or create a new agreement for the claim. After the request has been approved, the Agency shall write the supplement and/or new agreement and pay the consultant the amount of the claim. Inform the consultant that the final payment for the agreement is subject to audit. No further action in needed regarding the claim procedures. If the Agency does not agree with the consultant’s claim, proceed to step 3 of the procedures. Agreement Number: Exhibit J - Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 Page 1 of 2 COML Council Packet 11-14-23, Page 252 of 277 Step 3 Preparation of Support Documentation Regarding Consultant’s Claim(s) If the Agency does not agree with the consultant’s claim, the project manager shall prepare a summary for the Director of Public Works or Agency Engineer that included the following:  Copy of information supplied by the consultant regarding the claim; •Agency’s summation of hours by classification for each firm that should be included in the claim;  Any correspondence that directed the consultant to perform the additional work; •Agency’s summary of direct labor dollars, overhead costs, profit and reimbursable costs associatedwith the additional work; •Explanation regarding those areas in which the Agency does/does not agree with the consultant’sclaim(s);  Explanation to describe what has been instituted to preclude future consultant claim(s); and  Recommendations to resolve the claim. Step 4 Director of Public Works or Agency Engineer Reviews Consultant Claim and Agency Documentation The Director of Public Works or Agency Engineer shall review and administratively approve or disapprove the claim, or portions thereof, which may include getting Agency Council or Commission approval (as appropriate to agency dispute resolution procedures). If the project involves federal participation, obtain concurrence from WSDOT Local Programs and FHWA regarding final settlement of the claim. If the claim is not eligible for federal participation, payment will need to be from agency funds. Step 5 Informing Consultant of Decision Regarding the Claim The Director of Public Works or Agency Engineer shall notify (in writing) the consultant of their final decision regarding the consultant’s claim(s). Include the final dollar amount of the accepted claim(s) and rationale utilized for the decision. Step 6 Preparation of Supplement or New Agreement for the Consultant’s Claim(s) The agency shall write the supplement and/or new agreement and pay the consultant the amount of the claim. Inform the consultant that the final payment for the agreement is subject to audit. Agreement Number: Exhibit J - Local Agency A&E Professional Services Cost Plus Fixed Fee Consultant Agreement Revised 02/01/2021 Page 2 of 2 COML Council Packet 11-14-23, Page 253 of 277 Council Staff Report To:Agenda Item Number: From Department For Agenda of:Proceeding Type Subject Reviewed and Approved by: Expenditure Required:Amount Budgeted:Appropriation Required: Kevin Fuhr, City Manager 12993 Madeline Prentice, Director Finance 11/14/2023 New Business Resolution to adopt the 2024 Fee Schedule City Manager City Attorney Community Development Finance Fire Human Resources Parks, Rec, & Cultural Services Police Public Works Technology Services 0.00$0.00$0.00$ 22.1KB Action Requested Adopt the 2024 Fee Schedule resolution as presented. Packet Attachments (if any) Fee Schedule Resolution 2024.docx 54 - 2024 Schedule .pdf showing markup Fee Schedule pdf final 237.2KB COML Council Packet 11-14-23, Page 254 of 277 Overview Fiscal and Policy Implications Approve, Authorize, or Adopt: Provide Amended Direction: This resolution would approve the new 2024 Fee Schedule for all charges. A summary of the changes to the 2024 Fee Schedule is attached for your review and consideration. The 2024 fee schedule that was presented to Council at the budget workshops as well as the first budget hearing held on October 24, 2023 has been updated as follows: Fire Impact fees that were adopted at the October 24, 2023, City Council meeting have been included in the final 2024 Fee Schedule attached. We are requesting to include a Citywide Administrative Fee to the 2024 Fee Schedule to recoup convenience fees from customers using online application and payment portals to pay for utility bills, various permits, and activity fees at the discretion of the department utilizing the online service. InvoiceCloud, ActiveNet, Permitium, and various other on-line application and bill payment services used by the City charge a "convenience fee" whenever a customer uses the online service to submit an application, pay a bill or transact various other business with the City electronically. Currently, the City is being charged this fee (a percentage of the total transaction or a flat amount) by the online service companies we are currently using. We are requesting Council authority to charge the actual cost of the convenience fee to the customer and will work with the various online services to charge the customer the convenience fee at completion of the transaction. Prior to any change, customers will be informed of the new fee structure. The City participates in a State Business Licensing Service partnership with the Washington State Department of Revenue. Businesses seeking to obtain a new (or renew) a business license must be registered with the Department of Revenue, apply for a business license, acquire a city endorsement and pay the fee before a license is issued. The business licensing fee for a business located within the City of Moses Lake is listed on the DOR website and any changes to the fee structure must be updated on the DOR website before the fee can be charged. We have been informed by DOR that changes to the fees shown on the DOR website can take up to as many as 75 days from the date of adoption of the fee schedule resolution and subsequent notification to the DOR. Therefore, we do not anticipate the new tiered business license rate to become effective until 2/1/2024 (or later depending on final adoption of the fee schedule). Meter tampering fee - the city frequently experiences customers cutting locks (sometimes including damage to the meter) when water service has been disabled due to non-payment. City staff are requesting to implement a "meter tampering fee" that would be charged to the customer on record with the Utility Billing Department when a lock that has been placed on a meter due to non-payment is found to have been cut in order to restore water service without payment of outstanding water charges. To act as a deterrent, we are suggesting a fee of $250 for each occurrence of meter tampering (i.e., cut lock) and if the meter is also damaged, the customer would be charged the actual cost to repair or replace the meter. Parks, Recreation and Cultural Services (PRCS) are requesting to implement a late fee of 1% of the total invoice amount for PRCS invoices that are 30 days or more past due. The late fee would be cumulative, meaning that if the invoice remains unpaid after 60, 90, 120, etc. days, a 1% late fee is added to the total outstanding invoice amount, including any previously assessed late fees. Since we have previously established by ordinance that the appropriate way to modify the City's fee schedule is by resolution, that is how we are setting the fees to be effective January 1, 2024, (Business Licensing fees will become effective 2/1/2024 or as soon as DOR has updated the fees on the DOR website). These fees were used to develop the revenue estimates that are the basis of resources available to accomplish the 2024 budget that was presented to Council at the September 23, 2023 and October 17, 2023 budget workshops, and the first public hearing held on October 24, 2023. Options and Results The 2024 Fee Schedule will be effective January 1, 2024. Provide staff with specific changes, which would then need to be approved at the November 28, 2023 meeting (fee schedule would still be effective 1/1/2024). COML Council Packet 11-14-23, Page 255 of 277 No Action Taken: The Fee Schedule would remain unchanged, and the revenue estimates used in the 2024 budget may not be attained. COML Council Packet 11-14-23, Page 256 of 277 RESOLUTION NO. 3966 A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF MOSES LAKE, WASHINGTON SETTING THE CITY OF MOSES LAKE FEE SCHEDULE AS OF JANUARY 1, 2024 Recitals: 1. In connection with the municipal functions and operations of the City of Moses Lake, the City requires certain fees; and 2. It is appropriate to review such fees and adjust appropriately address costs; and 3. In keeping with the philosophy of setting City fees in amounts reflective of actual costs, it is appropriate at this time to revise certain fees to compensate the City for costs associated with various City functions and facilities. Now, Therefore, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF MOSES LAKE: Section 1. That the 2024 Fee Schedule of the City of Moses Lake pertaining to all fees is amended as set forth in Exhibit A. Section 2. Severability. If any sections, sentence, clause, or phrase of this Resolution shall be held to be invalid or unconstitutional by a court of competent jurisdiction, or its application held inapplicable to any person, property or circumstance, such invalidity or unconstitutionality or inapplicability shall not affect the validity or constitutionality of any other section, sentence, clause or phrase of this Resolution or its application to any other person, property or circumstance. Section 3. This Resolution shall be in full force and effect January 1, 2024. ADOPTED by the City Council on November 14, 2023. ________________________________________ Don Myers, Mayor ATTEST: ____________________________________ Debbie Burke, City Clerk COML Council Packet 11-14-23, Page 257 of 277 City of Moses Lake 2023 Fee Schedule Accepted by:Resolution 3923 & 3927 &3939 3.5 Estimated CPI Increase DEPART FEE TYPE FEE DESCRIPTION MLMC Section 2023 Fee 2024 Proposed Fee Change in fee % Change Citywide Administrative Copy charge‐per page RCW 42.56.120 $0.15 $0.15 Citywide Administrative Scan to electronic format‐per page (8‐1/12x11 one side)RCW 42.56.120 $0.10 $0.10 Citywide Administrative Every 4 files or attachments provided electronically RCW 42.56.120 $0.05 $0.05 Citywide Administrative Each gigabyte of electronic records transmission RCW 42.56.120 $0.10 $0.10 Citywide Administrative Storage media, container, envelope; postage/delivery RCW 42.56.120 Actual Cost Actual Cost Citywide Administrative Maps and oversized document scanning or printing (per page)$5.00 $5.00 Citywide Administrative Custom data requests (per hour)RCW 42.56.120 $50.00 $50.00 Citywide Administrative CD/DVD copy ‐ per media RCW 42.56.120 $1.00 $1.00 Citywide Administrative Return check charge $35.00 $35.00 Citywide Administrative Facility Rental Application Processing Fee $25.00 $25.00 Citywide Administrative Facility Rental Type 2 Mon‐Fri 8am‐5pm (per hour, 2‐hour  minimum)$30.00 $30.00 Citywide Administrative Facility Rental Type 2 after 5pm and Saturdays (per hour, 2‐hour  minimum)$70.00 $70.00 Citywide Administrative Facility Rental Type 3 Mon‐Fri 8am‐5pm (per hour, 2‐hour  minimum)$75.00 $75.00 Citywide Administrative Facility Rental Type 3 after 5 pm and Saturdays (per hour, 2‐hour  minimum)$100.00 $100.00 Citywide Administrative Facility – Café/Kitchen Rental (per day)$50.00 $50.00 Citywide Administrative Facility – Six Foot Table Rental (per day)$10.00 $10.00 Citywide Administrative Facility – A‐V Equipment Use (per day) $25.00 $25.00 Citywide Administrative Facility – IT set up & instructions on basic equipment use (per  hour)$50.00 $150.00 $100.00 200.00% **per Jim Citywide Administrative Facility – Custodian Services Clean‐Up Overtime Rate (per hour)$50.00 $50.00 $0.00 0.00% Citywide Administration Concessionaire agreement on City Property‐Non‐Profit  organization 10% of Gross Revenue 10% of Gross Revenue  Citywide Administration Concessionaire agreement on City Property‐For‐Profit entity  15% of Gross Revenue 15% of Gross Revenue  Citywide Administrative Facility Security Guard (per hour)$65.00 REMOVE Citywide Administrative Hearing Examiner Admin. Appeals - rate per hour 1.20.120 $50 $175 Citywide Administrative Online services (bill pay, application, activity, etc.)  convenience  fee ‐$ Cost recovery actual New POLICE Administrative Reports (incl accident)  (per page)RCW42.56.120 $0.15 $0.15 POLICE Administrative accident $0.00 REMOVE POLICE Administrative Photos (per photo)RCW42.56.120 $0.15 $0.15 POLICE Administrative DVD/CD copy per media (per DVD/CD)RCW42.56.120 $1.00 $1.00 POLICE Administrative Criminal History 5.02.020 $20.00 $20.00 POLICE Administrative Fingerprinting 5.02.020 $15.00 $15.00 POLICE Administrative Dog Lic. Annual 6.04.030 $10.00 $10.00 POLICE Administrative Dog Lic. Replacement 6.04.030 $5.00 $5.00 POLICE Administrative potentially dangerous Dog Lic.6.10.110 $100.00 $100.00 POLICE Administrative Dangerous Dog License 6.10.110 $300.00 $300.00 POLICE Administrative Potential Dangerous or Dangerous Dog Appeal Request $50.00 $50.00 See City Wide POLICE Administrative Bike License no fee no fee POLICE Administrative Concealed pistol license RCW 9.41.070 $49.25 $49.25 POLICE Administrative CPL Fingerprinting RCW 9.41.070 $32.00 $32.00 POLICE Administrative CPL late renewal RCW 9.41.070 $42.00 $42.00 POLICE Administrative Chicken License $0.00 REMOVE POLICE Administrative WATCH background checks (requested thru WSP)$12.00 REMOVE POLICE Administrative Thumb Drive RCW42.56.120 $10.00 $10.00 Fire Administrative conference room use 1/2 room (up to 50 occupants) (per hour)$21.00 $21.00 Fire Administrative Local, State, Federal Government fee for cleaning / maintenance $27.00 $27.00 Fire Administrative City of Moses Lake sponsored events no fee no fee Fire Administrative Ambulance Report $7.00 $7.25 $0.25 3.57% Fire Permit (Hazardous material) 1 Class 16.40.030 $165.00 $170.75 $5.75 3.48% Fire Permit (Hazardous material) 2 Classes 16.40.030 $275.00 $284.60 $9.60 3.49% Fire Permit (Hazardous material) 3 Classes 16.40.030 $420.00 $434.70 $14.70 3.50% Fire Permit (Hazardous material) 4 Classes or more than 4,000 gallons, 19,000 cubic feet, or 249,000 pounds of any single class 16.40.030 $555.00 $574.00 $19.00 3.42% Fire Permit (Hazardous material) 5 Classes or more than 5,000 gallons, 25,000 cubic feet, or 280,000 pounds of any single class 16.40.030 $715.00 $740.00 $25.00 3.50% Fire Permit (Hazardous material) Extremely Hazardous Substances, highly toxic, toxic, & pyrophoric materials of any amount 16.40.030 $1,102.50 $1,141.10 $38.60 3.50% Fire Permit (Hazardous material) Marijuana Extraction Systems/ Facilities 16.40.030 $689.00 $713.10 $24.10 3.50% Fire Permit (Hazardous material) Temporary membrane structures and tents exceeding 400 square feet 16.40.030 $166.00 $171.80 $5.80 3.49% Fire Operational Permit Aviation Facilitates, Commercial Repair Operations, Heliports,  Helistops & Fueling Facilities 16.40.030 $275.00 $284.60 $9.60 3.49% Fire Operational Permit Carnivals and Fairs 16.40.030 $165.00 $170.75 $5.75 3.48% Fire Operational Permit Combustible Dust producing operations 16.40.030 $194.00 $200.80 $6.80 3.51% Fire Operational Permit Dry Cleaning Plants using flammable solvents 16.40.030 $167.00 $172.85 $5.85 3.50% Fire Operational Permit Exhibits/ Trade Shows 16.40.030 $167.00 $172.85 $5.85 3.50% Fire Operational Permit High Piled Combustible Storage 16.40.030 $330.00 $341.55 $11.55 3.50% Fire Operational Permit Hot work operations 16.40.030 $138.00 $142.80 $4.80 3.48% Fire Operational Permit Hot work program 16.40.030 $194.00 $200.80 $6.80 3.51% Fire Operational Permit Industrial Oven 16.40.030 $660.00 $683.10 $23.10 3.50% Fire Operational Permit Lumber Yards 16.40.030 $165.00 $170.75 $5.75 3.48% Fire Operational Permit Battery systems having a liquid capacity of more than 50 gallons 16.40.030 $275.00 $284.60 $9.60 3.49% Fire Permit Fire protection systems, industrial process equipment regulated  by the fire code, LPG, Natural gas, flammable and combustible  liquid dispensing/distribution system and installation of private  fire hydrant: 16.40.030 Fire Permit $1 to $500 16.40.030 $55.00 $56.90 $1.90 3.45% Fire Permit $501 to $2,000‐ $55.00 for the first $500 Plus $6.60 for each additional $100 or fraction thereof, to and including $2,000 16.40.030 $55.00 $56.90 $1.90 3.45% 16.40.030 $6.60 $6.83 $0.23 3.48% Fire Permit $2,001 to $25,000‐ $154 for the first $2,000 Plus $31.00 for each  additional $1,000 or fraction thereof, to and including $25,000 16.40.030 $154.00 $159.35 $5.35 3.47% 16.40.030 $31.00 $32.00 $1.00 3.23% COML Council Packet 11-14-23, Page 258 of 277 DEPART FEE TYPE FEE DESCRIPTION MLMC Section 2023 Fee 2024 Proposed Fee Change in fee % Change Fire Permit $25,001 to $50,000‐ $711 for the first $25,000 Plus $85.00 for each additional $1,000 or fraction thereof, to and  including $50,000 16.40.030 $711.00 $735.85 $24.85 3.50% 16.40.030 $85.00 $87.95 $2.95 3.47% Fire Permit $50,001 and above 2.5% of project value 16.40.030 Fire Permit Private Fire Hydrant"s" each hydrant 16.40.030 $138.00 $142.80 $4.80 3.48% Fire Permit Private Fire Hydrant"s" up to 5 fire hydrants $690.00 REMOVE Fire Permit Private Fire  Hydrant"s" 6 or more 2.5% of project value REMOVE Fire Permit Fire Department Radio Coverage System 16.40.030 $690.00 $714.15 $24.15 3.50% Fire Plan Check Technology Fee ‐Project Value $2001 and above 16.40.030 $165.00 $170.75 $5.75 3.48% Fire Permit ‐ Special Event Fireworks / pyrotechnic displays:16.40.030 $204.00 $211.15 $7.15 3.50% Fire Permit ‐ Demolition Demolition of required Fire Protection System or Fire Alarm System: 16.40.030 $171.00 $177.00 $6.00 3.51% Fire Permit UST/AGT Decommissioning of flammable / combustible liquid  tanks: up to 1100 gallon capacity 16.40.030 $171.00 $177.00 $6.00 3.51% Fire Permit UST/AGT Decommissioning of flammable / combustible liquid  tanks: 1101‐ 10,000 gallon capacity 16.40.030 $330.00 $341.55 $11.55 3.50% Fire Permit UST/AGT Decommissioning of flammable / combustible liquid  tanks: 10,000 gallon capacity and above 16.40.030 $605.00 $626.15 $21.15 3.50% Fire Plan Check Plan review fees ‐ (% of total permit fee)16.40.030 70.00%70.00% Fire Plan Check 3rd Party Review  Cost Recover actual costs + technology 16.40.030 Cost Recovery actual Cost Recovery actual Fire Special Inspections Special / Technical Inspections ‐ Cost Recovery actual costs 16.40.030 Cost Recovery actual Cost Recovery actual  Fire False Alarms 3 False Alarms in any 3 month period:8.26.30 $210.00 $218.35 $8.35 3.98% Fire False Alarms 4 or more false alarms in 3 months (per response)8.26.30 $720.00 $745.20 $25.20 3.50% Fire MVA / Hazmat Supply recovery for foam, absorbents, or other materials ‐ Cost  recovery actual costs utilized to mitigate hazards CFR and RCW Cost Recovery actual Cost Recovery Actual Fire Operational Permit Hazardous Materials Super User category (Mandatory SARA Title  III Tier II reporter / mandatory facility action plan required) 16.40.030 $2,290.00 $2,375.15 $85.15 3.72% Fire Operational Permit Mobile Food Vehicle Annual Permit $50.00 NEW Fire Operational Permit Energy Storage System other than lead acid battery systems.$284.60 NEW Fire Re‐inspection Fee Charged on the 3rd inspection visit without compliance $75.00 NEW Fire Operational Permit Refrigeration systems above 5,000 pounds refrigerant $125.00 NEW Fire Fire Impact Fees Deferred Impact Administration‐nte 20/yr.‐per request 21.03.030(f)$85.00 NEW Fire Fire Impact Fees Independent Calculation per request 21.030.050(a)$100.00 NEW Fire Fire Impact Fees Single and Two Family Residential development $420+$21.04  Non refundable administrative cost per unit 21.03.170‐180 $441.89‐$462.93 NEW Fire Fire Impact Fees Multi‐Family initial $420+$21.04 Non refundable administrative  cost per unit 21.03.170‐180 $441.89+ NEW Fire Fire Impact Fees Hospitals and Clinics‐ which includes a non‐refundable  administrative fee of $.0365 per square foot 21.03.170‐180 (per  Square foot) $0.7665 NEW Fire Fire Impact Fees Skilled Nursing and Licensed Care Facilities‐which includes a non‐ refundable administrative fee of $.0365 per square foot 21.03.170‐180 (per  Square foot) $0.7665 NEW Fire Fire Impact Fees Hotel‐Motel Development‐ which includes a non‐refundable  administrative fee of $.013 per square foot 21.03.170‐180 (per  Square foot) $0.273 NEW Fire Fire Impact Fees Office Development‐which includes a non‐refundable  administrative fee of $.0035 per square foot 21.03.170‐180 (per  Square foot) $0.0735 NEW Fire Fire Impact Fees Retail Development‐which includes a non‐refundable  administrative fee of $.0035 per square foot 21.03.170‐180 (per  Square foot) $0.0735 NEW Fire Fire Impact Fees Industrial Development with no connected suppression water  storage on site‐which includes a non‐refundable administrative  fee of $.005 per square foot 21.03.170‐180 (per  Square foot) $0.105 NEW Fire Fire Impact Fees Industrial Development with full fire flow suppression water  storage on site‐which includes a non‐refundable administrative  fee of $.0035 per square foot 21.03.170‐180 (per  Square foot) $0.0735 NEW Fire Fire Impact Fees Restaurants‐which includes a non‐refundable administrative fee  of $.0015 per square foot 21.03.170‐180 (per  Square foot) $0.0315 NEW Fire Fire Impact Fees Churches‐which includes a non‐refundable administrative fee of  $.001 per square foot 21.03.170‐180 (per  Square foot) $0.021 NEW Fire Fire Impact Fees Education Development‐which includes a non‐refundable  administrative fee of $.001 per square foot 21.03.170‐180 (per  Square foot) $0.021 NEW Ambulance Transport Rate‐‐BLS Basic Life Support Transport Fee 2.30.050 $1,029.00 $1,029.00 Ambulance Transport Rate‐‐ALS Advanced Life Support Transport Fee 2.30.050 $1,181.25 $1,181.25 Ambulance Transport Rate‐‐BLS Non‐Resident BLS Transport Fee 2.30.050 $1,235.00 NEW Ambulance Transport Rate‐‐ALS Non‐Resident ALS Transport Fee 2.30.050 $1,326.00 NEW Ambulance Mileage Mileage fee for patient transport (loaded miles)2.30.050 $17.85 $18.47 $0.62 3.47% Ambulance Treatment w/ out transport Non‐resident on scene patient treatment / care without  transport.2.30.050 $305.00 NEW Ambulance Treatment w/ out transport On scene patient treatment / care without transport.2.30.050 $262.50 $271.69 $9.19 3.50% Ambulance School Dist. Athletic Standby Ambulance Standby for scheduled School District ‐ Cost Recovery  Athletic Events (per event)2.30.050 Cost Recovery Cost Recovery Ambulance Utility Rate Indexing CPI Adjustment for Ambulance Utility per Utility account (rounded to closest $.05) 2.30.110 $14.45 $17.20 $2.75 19.03% Ambulance Non‐residential Utility Fees Square Foot Fee for non‐residential structures ‐ 1 Additional  utility fee per 5,000 square feet or portion thereof to a maximum  of 25. 2.30.120 No change to current  methodology Ambulance Lodging Utility Fees Utility fee structure for hotels / motels ‐ 1/2 of total room count  shall be charged a per room utility fee 2.30.120 No change to current  methodology Ambulance Committed EMS Standby Standby time for non‐profit events (per hour, 1 hr. min)2.30.50 $220.50 Cost Recovery Ambulance Committed EMS Standby Standby time for profit events: cost per hour (per hour, 2hr min) 2.30.50 $220.50 Cost Recovery Ambulance Healthcare Education CPR / AED training‐‐layperson ‐ Cost recovery for course material 2.30.50 Cost Recovery Ambulance Healthcare Education CPR / Aed training‐‐professional rescuer /healthcare (per  student) 2.30.50 $57.75 $59.75 $2.00 3.46% Parks Administrative Past due invoice late fee (Assessed @ 30 days past due & each  successive 30‐day period until paid) $0.00 1% of past due balance New Parks Recreation Youth ‐Per player fee ‐ practice(baseball/softball/soccer)3.34.010 $7.00 $7.00 Parks Recreation Youth ‐Per player fee ‐ League(baseball/softball/soccer)3.34.010 $12.00 $12.00 Parks Recreation Adult ‐ Per player fee ‐ practice (baseball/softball/soccer)3.34.010 $9.00 $9.00 Parks Recreation Adult ‐ Per player fee ‐ League (baseball/softball/soccer)3.34.010 $20.00 $20.00 Parks Maintenance Picnic Table/Bench (each‐applicable to Special Events)3.34.010 $20.00 $21.00 $1.00 5.00% Parks Maintenance Garbage Can (each‐applicable to Special Events)3.34.010 $10.00 $11.00 $1.00 10.00% Parks Recreation Surf 'n Slide Daily Admission (per person)3.34.010 $9C/$17Y/$18A/$17S $5‐$19 ‐$4.00 ‐44.44% $2.00 11.76% COML Council Packet 11-14-23, Page 259 of 277 DEPART FEE TYPE FEE DESCRIPTION MLMC Section 2023 Fee 2024 Proposed Fee Change in fee % Change Parks Recreation Surf 'n Slide 10 Punch Card (per person)3.34.010 $80C/$160C/$170A/$160 S $90‐$180 $10.00 12.50% $20.00 12.50% Parks Recreation Surf 'n Slide Picnic Shelter (per hour)3.34.010 $20.00 $22.00 $2.00 10.00% Parks Recreation Surf 'n Slide Senior Season Pass In‐City (per person)3.34.010 $73.00 $76.00 $3.00 4.11% Parks Recreation Surf 'n Slide Senior Season Pass Out‐of‐City (per person)3.34.010 $84.00 $87.00 $3.00 3.57% Parks Recreation Surf 'n Slide Senior Season Pass In‐City Pre‐Season (per person) 3.34.010 $68.00 $71.00 $3.00 4.41% Parks Recreation Surf 'n Slide Senior Season Pass Out‐of‐City Pre‐Season (per  person) 3.34.010 $79.00 $82.00 $3.00 3.80% Parks Recreation Surf 'n Slide Adult Season Pass In‐City (per person)3.34.010 $79.00 $82.00 $3.00 3.80% Parks Recreation Surf 'n Slide Adult Season Pass Out‐of‐City (per person)3.34.010 $89.00 $93.00 $4.00 4.49% Parks Recreation Surf 'n Slide Adult Season Pass In‐City Pre‐Season (per person) 3.34.010 $73.00 $76.00 $3.00 4.11% Parks Recreation Surf 'n Slide Adult Season Pass Out‐of‐City Pre‐Season (per  person) 3.34.010 $84.00 $87.00 $3.00 3.57% Parks Recreation Surf 'n Slide Youth Season Pass In‐City (per person)3.34.010 $73.00 $76.00 $3.00 4.11% Parks Recreation Surf 'n Slide Youth Season Pass Out‐of‐City (per person)3.34.010 $84.00 $87.00 $3.00 3.57% Parks Recreation Surf 'n Slide Youth Season Pass In‐City Pre‐Season (per person) 3.34.010 $68.00 $71.00 $3.00 4.41% Parks Recreation Surf 'n Slide Youth Season Pass Out‐of‐City Pre‐Season (per  person) 3.34.010 $79.00 $82.00 $3.00 3.80% Parks Recreation Surf 'n Slide Child Season Pass In‐City (per person)3.34.010 $39.00 $41.00 $2.00 5.13% Parks Recreation Surf 'n Slide Child Season Pass Out‐of‐City (per person)3.34.010 $47.00 $49.00 $2.00 4.26% Parks Recreation Surf 'n Slide Child Season Pass In‐City Pre‐Season (per person) 3.34.010 $37.00 $39.00 $2.00 5.41% Parks Recreation Surf 'n Slide Child Season Pass Out‐of‐City Pre‐Season (per  person) 3.34.010 $42.00 $44.00 $2.00 4.76% Parks Recreation Group Swim Lessons ‐ All Levels 3.34.010 $42.00 $42.00 Parks Recreation Surf 'n Slide Body Boarding Lessons ‐ Flowrider 3.34.010 $52.00 $52.00 Parks Recreation Surf 'n Slide Flowboarding Lessons ‐ Standup 3.34.010 $52.00 $52.00 Parks Recreation Surf 'n Slide Private Rental 1 ‐ 100 Patrons (per hour)3.34.010 $1,023.00 $1,126.00 $103.00 10.07% Parks Recreation Surf 'n Slide Private Rental 101 ‐ 150 Patrons (per hour)3.34.010 $1,100.00 $1,210.00 $110.00 10.00% Parks Recreation Surf 'n Slide Private Rental 151 ‐ 250 Patrons (per hour)3.34.010 $1,254.00 $1,380.00 $126.00 10.05% Parks Recreation Surf 'n Slide Private Rental 251 ‐ 500 Patrons (per hour)3.34.010 $1,480.00 $1,628.00 $148.00 10.00% Parks Recreation Surf 'n Slide Private Rental 501 ‐ 1000 Patrons (per hour)3.34.010 $1,639.00 $1,803.00 $164.00 10.01% Parks Recreation Surf 'n Slide ‐ Semi‐private Lessons ‐ All Levels 3.34.010 $120.00 $120.00 Parks Recreation Surf 'n Slide ‐ Private Lessons ‐ All Levels 3.34.010 $240.00 $240.00 Parks Recreation Lifeguard Certification Class 3.34.010 $155.00 $175.00 $20.00 12.90% Parks Admin Picnic Shelter Rental ‐ 4 Hours 3.34.010 $55‐$75 $57‐$78 $2.00 3.64% $3.00 4.00% Parks Admin Picnic Shelter Rental ‐ 8 Hours 3.34.010 $80‐$100 $83‐$104 $3.00 3.75% $4.00 4.00% Parks Admin Special Event Application Fee 12.36.065 $75 ‐ $150 $75‐$175 $25.00 16.67% Parks Administrative Special Event‐Vendor Fee‐For Profit 12.36.065 15% of Gross Revenue $50 per day NEW Parks Admin Special Event‐Vendor Fee‐Non‐Profit 12.36.065 10% of Gross Revenue $35 per day NEW Parks Administrative Concessionaire Fee‐For Profit 15% of Gross Revenue 15% of Gross Revenue covered on Citywide Parks Administrative Concessionaire Fee‐Non‐Profit 10% of Gross Revenue 10% of Gross Revenue covered on Citywide Parks Administrative Vendor‐Seasonal‐Roaming‐(Ice Cream Truck)12.36.065 $100 per month NEW Parks Recreation/Museum Museum classes and programs ‐ to be determined by class size &  supplies 3.34.010 Parks Recreation Parks/Recreation Programs ‐ to be determined by class size &  supplies 3.34.010 Parks Recreation Recreational sports leagues ‐ to be determined by class size &  supplies 3.34.010 Parks Recreation Ice Skating Admission (per person)3.34.010 $4S/$6Y/$7A $3‐9$ Parks Recreation Ice Skating Admission Punch card 3.34.010 $30S/$50Y/$60A $40‐$80 $10.00 33.33% $20.00 33.33% Parks Recreation Ice Skate Rental (per person)3.34.010 $5.00 $4.00 ‐$1.00 ‐20.00% Parks Recreation Ice Skating Admission Punch card with Skates 3.34.010 $60S/$80Y/$90A $40‐$110 Parks Recreation Ice Skating Season Pass (Individual) no Skates 3.34.010 $15.75S/$36.75Y/$47.25 A $16‐$50 $0.25 1.59% $2.75 5.82% Parks Recreation Ice Skating Season Pass (Individual) with Skates 3.34.010 $47.25S/$68.25Y/$78.75 A $48‐$82 $0.75 21.16% $3.25 4.13% Parks Recreation winter ice program ‐ to be determined by class size & supplies 3.34.010 $9 ‐$200 Parks Recreation Group Broomball Party (per person)$9.00‐$10.00 REMOVE Parks Recreation Ice Rink Private Rental (per hour)3.34.010 $108‐$210 $131‐$249 $23.00 21.30% $39.00 18.57% Parks Maintenance Softball Field Use (per game)3.34.010 $23Y/$28A/$40 Schools $23Y/$28A/$40 Schools Parks Maintenance Baseball Field Use (per game)3.34.010 $28Y/$38A/$50 Schools $28Y/$38A/$50 Schools Parks Maintenance Soccer Field Use (per game)3.34.010 $20Y/$25A/$35 HS+  Schools NEW Parks Maintenance Softball Field Lighting (per hour)3.34.010 $15.00 $15.00 Parks Maintenance Soccer Field Lighting (per hour)3.34.010 $12.00 $12.00 Parks Maintenance Baseball Field Lighting (per hour)3.34.010 $18.00 $18.00 Parks Recreation Baseball/Softball Tournament Application Fee 3.34.010 $125.00 $125.00 Parks Maintenance Baseball/Softball Crowd Fencing (per event)3.34.010 $175.00 $175.00 Parks Admin Modifications 3.34.010 $5.00 ‐ $25.0 $5.00 ‐ $25.00 Parks Maintenance Baseball/Softball Temporary Field Fencing 3.34.010 $80.00 $80.00 Parks Maintenance Tennis Court Lighting 3.34.010 $1.75 for 50 mins New to fee schedule Parks Administrative Cascade Campground Tent Site 3.34.010 $35.00 $37.00 $2.00 5.71% Parks Administrative Cascade Campground Tent Site Processing Fee 3.34.010 $7.00 $7.00 Parks Administrative Cascade Campground RV Site 3.34.010 $40.00 $42.00 $2.00 5.00% Parks Administrative Cascade Campground RV Site Processing Fee 3.34.010 $7.00 $7.00 Parks Administrative Cascade Campground Group Site 3.34.010 $220.00 $228.00 $8.00 3.64% Parks Administrative Cascade Campground Group Site Processing Fee 3.34.010 $50.00 $50.00 Parks Administrative Cancellation Processing Fee (Campsite/Picnic Shelter)3.34.010 $15.00 $15.00 Parks Maintenance Cascade Campground Showers 3.34.010 $0.50 ‐ $3.75 New to fee schedule Parks Administrative Amphitheater Rental (Daily)3.34.010 $100.00 $104.00 $4.00 4.00% Parks General Rental Attendant 3.34.010 $30.00 per hour $30.00 per hour  Parks Recreation Community Garden Plot Rental (16‐80 sq. ft.)3.34.010 $11.00 $12.00 $1.00 9.09% Parks Recreation Community Garden Plot Rental (81‐160 sq. ft.)3.34.010 $22.00 $23.00 $1.00 4.55% Parks Recreation Community Garden Plot Rental (161‐280 sq. ft.)3.34.010 $27.00 $28.00 $1.00 3.70% Parks Recreation Community Garden Plot Rental (281‐512 sq. ft.)3.34.010 $32.00 $34.00 $2.00 6.25% Parks Maintenance Roto‐tilling garden plots (per lot size)3.34.010 $11/$22/$27/$33 $12/$23/$28/$34 $1.00 9.09% $1.00 3.03% Parks Museum & Art Center Museum & Art Center Membership (Jackrabbit)$1.00‐24.01 $1.00‐24.01 Parks Museum & Art Center Museum & Art Center Membership (Rattlesnake)$25.00 $25.00 Parks Museum & Art Center Museum & Art Center Membership (Rainbow Trout)$40.00 $40.00 Parks Museum & Art Center Museum & Art Center Membership (Coyote)$75.00 $75.00 Parks Museum & Art Center Museum & Art Center Membership (Bald Eagle)$250.00 $250.00COML Council Packet 11-14-23, Page 260 of 277 DEPART FEE TYPE FEE DESCRIPTION MLMC Section 2023 Fee 2024 Proposed Fee Change in fee % Change Parks Museum & Art Center Museum & Art Center Membership (Wild Horses)$500.00 $500.00 Parks Museum & Art Center Museum & Art Center Membership (Great Blue Heron)$1,000.00 $1,000.00 Parks Museum & Art Center Museum & Art Center Membership (Columbian Mammoth) $5,000.00 $5,000.00 Parks Museum & Art Center Museum Field Trips $5.00 per person $5.00 per person Parks Museum & Art Center Museum School Outreach Program $3 per Student $3 per Student  Parks Museum & Art Center Museum Rental‐Non Profit  $150.00 per hour $150.00 per hour  Parks Museum & Art Center Museum Rental‐For Profit  $297.12 per hour $297.12 per hour  Parks Museum & Art Center Commission for Museum Consignments 30% to the Museum 30% to the Museum  Parks Recreation Adopt‐A‐Street Application Fee 3.34.010 $50.00 $50.00 Parks Larson Recreation Center Adult Annual Pass 3.34.010 $360.00 $403.00 $43.00 11.94% Parks Larson Recreation Center Adult 6‐Month Pass 3.34.010 $204.00 $229.00 $25.00 12.25% Parks Larson Recreation Center Adult Monthly Pass 3.34.010 $36.00 $41.00 $5.00 13.89% Parks Larson Recreation Center Adult Daily Pass 3.34.010 $5.00 $6.00 $1.00 20.00% Parks Larson Recreation Center Adult Punch Card (12)3.34.010 $48.00 $54.00 $6.00 12.50% Parks Larson Recreation Center Teen & Seniors Annual Pass 3.34.010 $276.00 $309.00 $33.00 11.96% Parks Larson Recreation Center Teen & Seniors 6‐month Pass 3.34.010 $162.00 $182.00 $20.00 12.35% Parks Larson Recreation Center Teen & Seniors Monthly Pass 3.34.010 $28.00 $32.00 $4.00 14.29% Parks Larson Recreation Center Teen & Seniors Daily Pass 3.34.010 $4.00 $5.00 $1.00 25.00% Parks Larson Recreation Center Teen & Seniors Punch Card Pass (12)3.34.010 $28.00 $32.00 $4.00 14.29% Parks Larson Recreation Center Youth Annual Pass 3.34.010 $150.00 $168.00 $18.00 12.00% Parks Larson Recreation Center Youth 6‐month Pass 3.34.010 $87.00 $98.00 $11.00 12.64% Parks Larson Recreation Center Youth Monthly Pass 3.34.010 $15.50 $18.00 $2.50 16.13% Parks Larson Recreation Center Youth Daily Pass 3.34.010 $3.00 $4.00 $1.00 33.33% Parks Larson Recreation Center Youth Punch Card Pass (12)3.34.010 $24.00 $27.00 $3.00 12.50% Parks Larson Recreation Center Sage Room Rental‐ Non Profit ‐per hour 3.34.010 $40.00 $45.00 $5.00 12.50% Parks Larson Recreation Center Cascade Room Rental‐Non Profit‐per hour 3.34.010 $62.00 $70.00 $8.00 12.90% Parks Larson Recreation Center Lake Room Rental‐Non Profit ‐per hour 3.34.010 $50.00 $56.00 $6.00 12.00% Parks Larson Recreation Center Cascade/Lake Room Rental‐ Non Profit‐per hour 3.34.010 $75.00 $84.00 $9.00 12.00% Parks Larson Recreation Center Gymnasium Rental‐Non Profit‐per hour 3.34.010 $150.00 $168.00 $18.00 12.00% Parks Larson Recreation Center Kitchen Rental‐Non Profit‐per hour 3.34.010 $35.00 $40.00 $5.00 14.29% Parks Larson Recreation Center Damage Deposit‐Non Profit‐REFUNDABLE 3.34.010 $125.00 $125.00 Parks Larson Recreation Center Damage Deposit with Alcohol‐Non profit‐REFUNDABLE 3.34.010 $500.00 $500.00 Parks Larson Recreation Center Sage Room Rental‐For Profit‐per hour 3.34.010 $60.00 $68.00 $8.00 13.33% Parks Larson Recreation Center Cascade Room Rental‐For Profit‐per hour 3.34.010 $94.80 $107.00 $12.20 12.87% Parks Larson Recreation Center Lake Room Rental‐For Profit‐per hour 3.34.010 $76.50 $86.00 $9.50 12.42% Parks Larson Recreation Center Cascade/Lake Room Rental‐For Profit‐per hour 3.34.010 $122.10 $137.00 $14.90 12.20% Parks Larson Recreation Center Gymnasium Rental‐For Profit‐per hour 3.34.010 $297.12 $333.00 $35.88 12.08% Parks Larson Recreation Center Kitchen Rental‐For Profit‐per hour 3.34.010 $49.95 $56.00 $6.05 12.11% Parks Larson Recreation Center Damage Deposit‐For Profit‐REFUNDABLE 3.34.010 $200.00 $200.00 Parks Larson Recreation Center Damage Deposit With Alcohol‐For Profit‐REFUNDABLE 3.34.010 $500.00 $500.00 Parks Larson Recreation Center Application Fee‐ Non refundable 3.34.010 $25.00 $25.00 Parks Larson Recreation Center Gym Rental for Athletic Practices‐per hour 3.34.010 $55.00 $55.00 Parks Larson Recreation Center LRC Pickleball/Badminton Court Rental‐per hour/per court 3.34.010 $25.00 $25.00 Parks Larson Recreation Center Birthday Party Package Ice Rink (1‐10 participants) 2 hours 3.34.010 $220.00 $220.00 Parks Larson Recreation Center Birthday Party Ice Rink Additional Participants‐per participant 3.34.010 $22.00 $22.00 Parks Larson Recreation Center Summer Student Membership‐with current hs/College ID‐100  day membership  3.34.010 $100.00  $100.00 Parks Larson Recreation Center Roller Skating Admission (Discounted Days) (per person)  3.34.010 $1S/$1Y/$2A $2S/$2Y/$2A $1.00 100.00% Parks Larson Recreation Center Roller Skating Admission (per person)  3.34.010 $4S/$4Y/$5A $5S/$5Y/$6A $1.00 25.00% $1.00 20.00% Parks Larson Recreation Center Roller Skate Rental ‐per session 3.34.010 $1.00 $2.00 $1.00 100.00% Parks Larson Recreation Center Birthday Party Package (Roller Rink) (1‐10 participants) per  session 3.34.010 $155.00 $155.00 Parks Larson Recreation Center Roller Skate Rental ‐per hour 3.34.010 $125.00 $125.00 Parks Larson Recreation Center Roller Skate Rental Additional Participants (includes skates) 3.34.010 $4/person $1‐6/person Parks Compass Court ‐ Food Truck Court Food Vendor Fee Per Day 3.34.010 $25.00 $25.00 Parks Compass Court ‐ Food Truck Court Non Food Vendor Fee Per Day 3.34.010 $10.00 $10.00 Parks Compass Court ‐ Food Truck Court Food Vendor Fee Per Day Special Event 3.34.010 $125.00 $125.00 Parks Compass Court ‐ Food Truck Court Non Food Vendor Fee Per Day Special Event 3.34.010 $50.00 $50.00 Parks Compass Court ‐ Food Truck Court Cleaning Fee Per Hour 3.34.010 $50.00 $50.00 Finance Business License Bus License Fee ‐ General, Resident & Non‐Resident 5.04.080 $85.00/year Tiered rate based on  number of employees  (FTE).Change Finance Business License Tax‐Exempt Non‐Profit 5.04.080 $0.00 $0.00 NEW Finance Business License 1 through 5 Employees 5.04.080 $85.00/year $85/year NEW Finance Business License 6 through 15 Employees 5.04.080 $85.00/year $155/year NEW Finance Business License 16 through 50 Employees 5.04.080 $85.00/year $235/year NEW Finance Business License 51 through 100 Employees 5.04.080 $85.00/year $445/year NEW Finance Business License 101 or more Employees 5.04.080 $85.00/year $550/year NEW Finance Business License Temporary Vendor 5.06.080 $25.00/90 days $25.00/90 days Finance Business License Mobile and Street Food Vendor 5.07.060 $25.00/90 days $25.00/90 days Finance Screening Fee Solicitors 5.02.010 $85.00 $85.00 Finance Screening Fee Taxicabs 5.02.010 $85.00 $85.00 Finance Screening Fee Application fee pawnbrokers/2nd hand dealer 5.16.030 $98.00 $85.00 ($13.00) Finance Business License Bus. license fee ‐  carnival 1st day 5.02.010 $155.00 $155.00 Finance Business License ‐ carnival 2nd day 5.16.030 $75.00 $75.00 Finance Business License ‐ carnival 3rd plus 5.16.030 $50.00 $50.00 Finance Business License Bus. license fee ‐ Circus 1st day 5.16.030 $155.00 $155.00 Finance Business License ‐ Circus 2nd day plus 5.16.030 $75.00 $75.00 Finance Business License Bus license fee ‐ Road show 1st day 5.16.030 $65.00 $65.00 Finance Business License ‐ Road show 2nd day plus 5.16.030 $35.00 $35.00 Finance Business License Telecommunication license 5.50.030 $1,100.00 $1,100.00 Finance Business License Telecommunication license ‐ renewal 5.50.030 $550.00 $550.00 Finance Business License Telecommunication franchise 5.50.030 $3,300.00 $3,300.00 Finance Business License Telecommunication franchise ‐ renewal 5.50.030 $1,650.00 $1,650.00 Finance Business License Cable Franchise 5.50.030 $4,400.00 $4,400.00 Finance Business License Cable Franchise ‐ renewal 5.50.030 $2,200.00 $2,200.00 Utility Solid Waste/Garbage Rates See Attachment A below 8.08.140 Utility Fixed Water Charge Single Family Residential  .75" Meter 13.12.010 $23.65 $24.83 $1.18 5.00% Utility Fixed Water Charge Single Family Residential  1" Meter 13.12.010 $26.24 $27.55 $1.31 5.00% Utility Fixed Water Charge Single Family Residential  1.5" Meter 13.12.010 $34.07 $35.78 $1.70 5.00% Utility Fixed Water Charge Single Family Residential  2" Meter 13.12.010 $73.25 $76.91 $3.66 5.00% Utility Consumption Charge (per 100 cf)Single Family Tier 1 (0‐1,000 cubic feet)13.12.010 $0.44 $0.46 $0.02 5.00% Utility Consumption Charge (per 100 cf)Single Family Tier 2 (1,001‐3,000 cubic feet)13.12.010 $1.33 $1.40 $0.07 5.00% Utility Consumption Charge (per 100 cf)Single Family Tier 3 (over 3,000 cubic feet)13.12.010 $2.65 $2.78 $0.13 5.00% Utility Fixed Water Charge Duplex .75" Meter 13.12.035 $47.30 $49.67 $2.37 5.00% Utility Fixed Water Charge Duplex 1" Meter 13.12.015 $52.48 $55.10 $2.62 5.00%COML Council Packet 11-14-23, Page 261 of 277 DEPART FEE TYPE FEE DESCRIPTION MLMC Section 2023 Fee 2024 Proposed Fee Change in fee % Change Utility Fixed Water Charge Duplex 1.5" Meter 13.12.015 $68.14 $71.55 $3.41 5.00% Utility Fixed Water Charge Duplex 2" Meter 13.12.015 $146.50 $153.83 $7.33 5.00% Utility Consumption Charge (per 100 cf)Duplex Tier 1 (0‐2,000 cubic feet)13.12.015 $0.44 $0.46 $0.02 5.00% Utility Consumption Charge (per 100 cf)Duplex Tier 2 (2,001‐6,000) cubic feet)13.12.015 $1.33 $1.40 $0.07 5.00% Utility Consumption Charge (per 100 cf)Duplex Tier 3 (over 6,000 cubic feet)13.12.015 $2.65 $2.78 $0.13 5.00% Utility Fixed Water Charge Multi‐Family  .75" Meter 13.12.020 $37.49 $39.36 $1.87 5.00% Utility Fixed Water Charge Multi‐Family     1" Meter 13.12.020 $41.61 $43.69 $2.08 5.00% Utility Fixed Water Charge Multi‐Family  1.5" Meter 13.12.020 $54.01 $56.71 $2.70 5.00% Utility Fixed Water Charge Multi‐Family     2" Meter 13.12.020 $116.12 $121.93 $5.81 5.00% Utility Fixed Water Charge Multi‐Family     3" Meter    13.12.020 $198.87 $208.81 $9.94 5.00% Utility Fixed Water Charge Multi‐Family     4" Meter 13.12.020 $323.06 $339.22 $16.15 5.00% Utility Consumption Charge (per 100 cf)Multi‐Family   13.12.020 $0.89 $0.93 $0.04 5.00% Utility Fixed Water Charge Commercial    .75" Meter 13.12.020 $37.49 $39.36 $1.87 5.00% Utility Fixed Water Charge Commercial       1" Meter 13.12.020 $41.61 $43.69 $2.08 5.00% Utility Fixed Water Charge Commercial    1.5" Meter 13.12.020 $54.01 $56.71 $2.70 5.00% Utility Fixed Water Charge Commercial       2" Meter 13.12.020 $116.12 $121.93 $5.81 5.00% Utility Fixed Water Charge Commercial       3" Meter 13.12.020 $198.87 $208.81 $9.94 5.00% Utility Fixed Water Charge Commercial       4" Meter 13.12.020 $323.06 $339.22 $16.15 5.00% Utility Fixed Water Charge Commercial       6" Meter 13.12.020 $447.21 $469.57 $22.36 5.00% Utility Fixed Water Charge Commercial       8" Meter 13.12.020 $778.35 $817.27 $38.92 5.00% Utility Consumption Charge (per 100 cf)Commercial 13.12.020 $1.07 $1.12 $0.05 5.00% Utility Fixed Water Charge Irrigation   .75" Meter 13.12.020 $37.49 $39.36 $1.87 5.00% Utility Fixed Water Charge Irrigation      1" Meter 13.12.020 $41.61 $43.69 $2.08 5.00% Utility Fixed Water Charge Irrigation   1.5" Meter 13.12.020 $54.01 $56.71 $2.70 5.00% Utility Fixed Water Charge Irrigation       2" Meter 13.12.020 $116.12 $121.93 $5.81 5.00% Utility Fixed Water Charge Irrigation       3" Meter 13.12.020 $198.87 $208.81 $9.94 5.00% Utility Fixed Water Charge Irrigation       4" Meter 13.12.020 $323.06 $339.22 $16.15 5.00% Utility Consumption Charge (per 100 cf)Irrigation Tier 1 (0‐1,000 cubic feet)13.12.020 $0.44 $0.46 $0.02 5.00% Utility Consumption Charge (per 100 cf)Irrigation Tier 2 (1,001‐3,000 cubic feet)13.12.020 $1.33 $1.40 $0.07 5.00% Utility Consumption Charge (per 100 cf)Irrigation Tier 3 (over 3,000 cubic feet)13.12.020 $2.65 $2.78 $0.13 5.00% Utility Consumption Charge (per 100 cf)Irrigation $1.31 Remove Utility Fixed Water Charge Industrial   .75" Meter 13.12.020 $37.49 $39.36 $1.87 5.00% Utility Fixed Water Charge Industrial      1" Meter 13.12.020 $41.61 $43.69 $2.08 5.00% Utility Fixed Water Charge Industrial   1.5" Meter 13.12.020 $54.01 $56.71 $2.70 5.00% Utility Fixed Water Charge Industrial      2" Meter 13.12.020 $116.12 $121.93 $5.81 5.00% Utility Fixed Water Charge Industrial      3" Meter 13.12.020 $198.87 $208.81 $9.94 5.00% Utility Fixed Water Charge Industrial      4" Meter 13.12.020 $323.06 $339.22 $16.15 5.00% Utility Fixed Water Charge Industrial      6" Meter 13.12.020 $447.21 $469.57 $22.36 5.00% Utility Fixed Water Charge Industrial      8" Meter 13.12.020 $778.35 $817.27 $38.92 5.00% Utility Consumption Charge (per 100cf)Industrial 13.12.020 $1.07 $1.12 $0.05 5.00% Utility Fixed Sewer Charge Single Family Residential 13.12.030 $39.89 $41.88 $1.99 5.00% Utility Fixed Sewer Charge Duplex 13.12.035 $79.79 $83.78 $3.99 5.00% Utility Fixed Sewer Charge Multi‐Family Unit (per unit)$11.26 $11.82 $0.56 5.00% Utility Fixed Sewer Charge Commercial 13.12.040 $42.80 $44.94 $2.14 5.00% Utility Consumption Charge (per 100cf)Commercial Sewer Consumption 13.12.040 $1.91 $2.01 $0.10 5.00% Utility Fixed Sewer Charge Industrial 13.12.040 $48.14 $50.55 $2.41 5.00% Utility Consumption Charge (per 100cf)Industrial Sewer Consumption 13.12.040 $2.11 $2.22 $0.11 5.00% Utility Stormwater Residential Residential 13.03.020 $6.77 $7.11 $0.34 5.00% Utility Stormwater Non‐residential 0‐6,000 sf impervious ground cover 13.03.020 $6.77 $7.11 $0.34 5.00% Utility Stormwater Non‐residential 6,001‐15,000 sf impervious ground cover 13.03.020 $11.43 $12.01 $0.57 5.00% Utility Stormwater Non‐residential 15,001‐30,000 sf impervious ground cover 13.03.020 $16.68 $17.52 $0.83 5.00% Utility Stormwater Non‐residential 30,001‐60,000 sf impervious ground cover 13.03.020 $33.25 $34.92 $1.66 5.00% Utility Stormwater Non‐residential 60,001‐120,000 sf impervious ground cover 13.03.020 $66.24 $69.56 $3.31 5.00% Utility Stormwater Non‐residential 120,001‐240,000 sf impervious ground cover 13.03.020 $132.56 $139.19 $6.63 5.00% Utility Stormwater Non‐residential Over 240,000 sf impervious ground cover 13.03.020 $198.83 $208.77 $9.94 5.00% Utility Administrative After‐Hour Service Charge 13.12.053 $100.00 $100.00 $0.00 0.00% Utility Administrative Late Payment Charge 13.12.085 *Minimum of $5 or 2% *Minimum of $5 or 2% Utility Administrative Disconnect For Non‐Payment $50.00 $65.00 $15.00 30.00% Utility Administrative Sign in Fee 13.12.085 $15.00 $15.00 Utility Administrative Temporary Water Service Fee $25.00 $25.00 Utility Administrative Return Trip Meter Service Fee $25.00 $25.00 Utility Administrative Meter Bench Test $500.00 $500.00 Utility Administrative Door Tag Fee $25.00 $25.00 Utility Administrative Disconnection of Water for non‐compliance with MLMC  13.07.06A to repair/stop water leak 13.07.06A $65.00 $65.00 Utility Administrative Reconnection of Water for non‐compliance with MLMC  13.07.06A to repair/stop water leak 13.07.06A $65.00 $65.00 Utility Administrative Meter tamper fee 13.12 $0.00 $250.00 New Public Works Water main tapping fee 3/4" ‐ 2" tap $164.85 $170.62 $5.77 3.50% Public Works Water main tapping fee 4" ‐ 6" tap $369.60 $382.54 $12.94 3.50% Public Works Water main tapping fee 8" tap $448.35 $464.04 $15.69 3.50% Public Works Water main tapping fee 10" tap $569.10 $589.02 $19.92 3.50% Public Works Water main tapping fee 12" tap $659.40 $682.48 $23.08 3.50% Public Works Water sample Purity test per sample 13.05.110 $113.40 $117.37 $3.97 3.50% Public Works Filling and flushing Newly constructed water mains  Per 100 ft of line 13.07.070 $27.30 $28.26 $0.96 3.50% Public Works water meter 3/4" meter 3.62.010 & .020 $397.95 $411.88 $13.93 3.50% Public Works water meter 1" meter 3.62.010 & .020 $499.80 $517.29 $17.49 3.50% Public Works water meter 1‐1/2" meter 3.62.010 & .020 $967.05 $1,000.90 $33.85 3.50% Public Works water meter 2" meter 3.62.010 & .020 $1,022.70 $1,058.49 $35.79 3.50% Public Works Previously installed water srvc 3/4" service $2,274.30 $2,353.90 $79.60 3.50% Public Works Previously installed water srvc 1" service $3,412.50 $3,531.94 $119.44 3.50% Public Works Previously installed water srvc 1‐1/2" to 2" service $4,549.65 $4,708.89 $159.24 3.50% Public Works Connect to existing main Any size (up to 4 hours)3.58.010 $415.80 $430.35 $14.55 3.50% Public Works Connect to existing main After 4 hours (ea. additional hr. w/ service truck & 2 workers (per  hour) $210.00 $217.35 $7.35 3.50% Public Works Engineering inspector overtime Charge for working outside of normal hours (per hr.)$84.00 $86.94 $2.94 3.50% Public Works Assignment of Water Rights Domestic water rights charge per equivalent residential unit  (ERU) when subdividing residential, commercial, and industrial  real property.  1ERU = 0.6 ACRE FOOT of Water use. (per ERU  min 1ERU per lot) 17.03.060 1260 Was updated in  November of 2022;  resolution 3920  $2,100.00 $2,173.50 $73.50 3.50% Public Works Water System Development Chrg 3/4" water meter 3.62.010 $1,506.75 $1,559.49 $52.74 3.50% Public Works Water System Development Chrg 1" water meter 3.62.010 $2,559.90 $2,649.50 $89.60 3.50% Public Works Water System Development Chrg 1‐1/2" water meter 3.62.010 $5,098.80 $5,277.26 $178.46 3.50% Public Works Water System Development Chrg 2" water meter 3.62.010 $8,187.90 $8,474.48 $286.58 3.50% Public Works Water System Development Chrg 3" water meter 3.62.010 $15,444.45 $15,985.01 $540.56 3.50% Public Works Water System Development Chrg 4" water meter 3.62.010 $30,883.65 $31,964.58 $1,080.93 3.50% Public Works Water System Development Chrg 6" water meter 3.62.010 $64,604.40 $66,865.55 $2,261.15 3.50% Public Works Water System Development Chrg 8" water meter 3.62.010 $122,125.50 $126,399.89 $4,274.39 3.50%COML Council Packet 11-14-23, Page 262 of 277 DEPART FEE TYPE FEE DESCRIPTION MLMC Section 2023 Fee 2024 Proposed Fee Change in fee % Change Public Works Water System Development Chrg 10" water meter 3.62.010 $186,842.25 $193,381.73 $6,539.48 3.50% Public Works Sewer System Development Chrg 3/4" water meter 3.62.020 $898.80 $930.26 $31.46 3.50% Public Works Sewer System Development Chrg 1" water meter 3.62.020 $1,527.75 $1,581.22 $53.47 3.50% Public Works Sewer System Development Chrg 1‐1/2" water meter 3.62.020 $3,028.20 $3,134.19 $105.99 3.50% Public Works Sewer System Development Chrg 2" water meter 3.62.020 $4,788.00 $4,955.58 $167.58 3.50% Public Works Sewer System Development Chrg 3" water meter 3.62.020 $9,167.55 $9,488.41 $320.86 3.50% Public Works Sewer System Development Chrg 4" water meter 3.62.020 $18,328.80 $18,970.31 $641.51 3.50% Public Works Sewer System Development Chrg 6" water meter 3.62.020 $38,209.50 $39,546.83 $1,337.33 3.50% Public Works Sewer System Development Chrg 8" water meter 3.62.020 $72,473.10 $75,009.66 $2,536.56 3.50% Public Works Sewer System Development Chrg 10" water meter 3.62.020 $110,937.75 $114,820.57 $3,882.82 3.50% Public Works Signage V‐Lock Fee Fastener base for street signs.  Contractor can purchase equal  product elsewhere $36.75 $38.04 $1.29 3.50% Public Works ‐  NEW FEE Engineering Plan Review  Administrative Fee Covers initial administrative processing costs for engineering plan  submission. $80.00 per submission NEW Public Works Engineering plan review This fee is transitioning to Community Development to align with  the Development Review Program Manager position.    $400 min, $100 for each add'l sheet Move to Comm. Dev. Public Works Engineering Plan Review Engineering Plan Review by 3rd Party (When required by  Municipal Services Director) ‐ $1000 deposit w/ Actual Cost  Recovery* $0.00 $0.00 $0.00 Public Works Stormwater Report Review Stormwater Report Review by City Staff ($400 deposit w/ Actual  Cost Recovery) $0.00 $0.00 $0.00 Public Works Street obstruction permit Inspection fee ‐ 2.5% of construction costs, $50 min 3.54.010 $0.00 $0.00 $0.00 Public Works Sewer Discharge Permit New discharge permit application 13.05.170 $3,675.00 $3,803.63 $128.63 3.50% Public Works Sewer Discharge Permit Discharge permit renewal 13.05.170 $1,785.00 $1,847.48 $62.48 3.50% Public Works Sewer Discharge Permit Annual Discharge permit fee 13.05.170 $892.50 $923.74 $31.24 3.50% Public Works Stormwater Appeal Fee Pursuant to MLMC 1303.050 13.03.050 $57.75 $59.77 $2.02 3.50% Public Works hydrant rental Backflow Preventer (per day)13.09.060 $5.25 $5.43 $0.18 3.50% Public Works hydrant rental fire hydrant meter rental  per day 13.12.090 $5.25 $5.43 $0.18 3.50% Public Works hydrant rental fire hydrant usage (per 100 cf)13.12.090 $1.03 $1.07 $0.04 3.50% Public Works hydrant rental fire hydrant rental with no city meter available ‐ est. usage + 13.12.090 $8.40 $8.69 $0.29 3.50% Public Works ‐  NEW FEE Re‐inspection Fee Work concealed without inspection or work not ready at the  time of inspection will be charged a re‐inspection fee $80.00 per trip NEW Public Works ‐  NEW FEE Latecomer Contract Fee Fee for establishing a latecomer contract per MLMC 3.65.080.  (resolution 3493, 1/27/2015) 3.65 $1,500.00 NEW Public Works Technology Fee If not covered by IT Technology fee 1 %NEW Comm Dev Sidewalk Use Permits One time application fee of $150.00, each additional yearly fee 12.14 $80.00 $83.00 $3.00 3.75% Comm Dev Sidewalk Use Permits Sidewalk Use Fee and applicable leasehold taxes based on FMV  upon license issuance (minimum fee $75.00)12.14 same Comm Dev Land Use Annexation RCW 35A.14 $1,280 $1,325 $45.00 3.52% Comm Dev Land Use Appeals 20.11 $770 $797 $27.00 3.51% Comm Dev Land Use Code Interpretation 18.88.030 $75 $78 $3.00 4.00% Comm Dev Land Use Comp Plan Amendment ‐ Text 19.55 $840 $870 $30.00 3.57% Comm Dev Land Use Comp Plan Amendment ‐ Map 19.55 $1,050 $1,087 $37.00 3.52% Comm Dev Land Use Conditional Use Permit 19.55 $1,280 $1,325 $45.00 3.52% Comm Dev Land Use CRITICAL AREA PERMIT REVIEW: Comm Dev Land Use           Aquifer Recharge Area 19.03.140 $300 $311 $11.00 3.67% Comm Dev Land Use           Floodplain Development 19.03.150 $300 $311 $11.00 3.67% Comm Dev Land Use           Geologically Hazardous Areas 19.03.160 Actual cost for professional review Comm Dev Land Use           Habitat Review 19.03.170 $300 $311 $11.00 3.67% Comm Dev Land Use           Stream Buffers 19.03.170 $300 $311 $11.00 3.67% Comm Dev Land Use           Wetlands 19.06 $300 $311 $11.00 3.67% Comm Dev Land Use Development Agreement 12.4 $1,680 $1,739 $59.00 3.51% Comm Dev Land Use ENVIRONMENTAL POLICY ACTIONS: Comm Dev Land Use           Environmental Impact Statement (Recovery of all  consultant costs will be billed in addition to the fee)14.06 $700 $725 $25.00 3.57% Comm Dev Land Use           NEPA Review 14.06 $1,050 $1,087 $37.00 3.52% Comm Dev Land Use           SEPA Review (time required is comparable to processing a  subdivision application)14.06 $370 $1,500 $1,130.00 305.41% Comm Dev Land Use           SEPA Co‐Lead (per hour)14.06 $55 $57 $2.00 3.64% Comm Dev Land Use Hearing Examiner Charges 18.8 Actual cost w/ $400 deposit Comm Dev Land Use Landscape Plan Review Fee (not submitted with subdivision) 18.57.050 $75.00 NEW Comm Dev Land Use Landscape Plan Re‐Review Fee (subdivision or other)18.57.050 $75.00 NEW Comm Dev Land Use MULTIFAMILY TAX EXEMPTION FEES Comm Dev Land Use           MFTE Application Base Fee 18.23 $270.00 $280.00 $10.00 3.70% Comm Dev Land Use           MFTE County Assessor Pass through Fee 18.23.050 $350.00 NEW but listed in MLMC 18.23 Comm Dev Land Use           MFTE Annual Monitoring Fee 18.23 $75.00 $78.00 $3.00 4.00% Comm Dev Land Use           8‐year tax exemption request 18.23 $1,038.42 $1,075.00 $36.58 3.52% Comm Dev Land Use           12‐year tax exemption request (affordable housing  requirements apply)18.23 $1,500.00 $1,553.00 $53.00 3.53% Comm Dev Land Use Nonconforming Use ‐ Extension or Continuation (nonconforming  determination)18.69 $700.00 $725.00 $25.00 3.57% Comm Dev Land Use Nonconforming Use ‐ Remodeling a nonconforming use 18.69.050 $700.00 $725.00 $25.00 3.57% Comm Dev Land Use Nonconforming Use ‐ Bi‐annual monitoring / Inspection 18.69 $150.00 $155.00 $5.00 3.33% Comm Dev Land Use Pre‐application review (fee will be credited towards next permit  application fee)20.05.020 $275.00 NEW Comm Dev Land Use Right of Way Vacation 12.44.020 $300.00 $311.00 $11.00 3.67% Comm Dev Land Use Appraisal for ROW Vacation (3rd Party Appraisal)12.44.030 Actual Cost w/$1,500  Deposit Actual Cost w/$1,500  Deposit Comm Dev Land Use SHORELINE DEVELOPMENT APPLICATIONS: Comm Dev Land Use           Shoreline Master Plan Amendment 18.10.060 $2,000 $2,070 $70.00 3.50% Comm Dev Land Use           Shoreline Management Base Fee 18.10.060 $160 $166 $6.00 3.75% Comm Dev Land Use           Shoreline Substantial Development Permit 18.10.060 $315 $326 $11.00 3.49% Comm Dev Land Use           Shoreline Conditional Use Permit 18.10.060 $315 $326 $11.00 3.49% Comm Dev Land Use           Shoreline Exemption ‐ no additional fee required 18.10.060 Comm Dev Land Use           Shoreline Variance 18.10.060 $650 $673 $23.00 3.54% Comm Dev Land Use SUBDIVISION / PLATTING RELATED APPLICATIONS:  Comm Dev Land Use           Binding Site Plan 17.18 $850 plus $50 per lot $880 plus $52 per lot $30.00 3.53% $2.00 4.00% Comm Dev Land Use           Boundary Line Adjustment / Lot Consolidation 17.42 $350 $362 $12.00 3.43% Comm Dev Land Use           Expiration of subdivision (Major or Short) / Extension of  Time 17.12.100 $150 $155 $5.00 3.33%COML Council Packet 11-14-23, Page 263 of 277 DEPART FEE TYPE FEE DESCRIPTION MLMC Section 2023 Fee 2024 Proposed Fee Change in fee % Change Comm Dev Land Use           Subdivision Application ‐ Preliminary Short Subdivision (1‐9  lots)17.09 $840 plus $50 per lot $870 plus $52 per lot $30.00 3.57% $2.00 4.00% Comm Dev Land Use           Subdivision Application ‐ Final Short Subdivision 17.09 $210 $217 $7.00 3.33% Comm Dev Land Use           Subdivision Application ‐ Preliminary Major Subdivision  (10+ lots)17.12 $1710 plus $50 per lot $1770 plus $52 per lot $60.00 3.51% $2.00 4.00% Comm Dev Land Use           Subdivision Application ‐ Final Major Subdivision 17.12 $420 $435 $15.00 3.57% Comm Dev Land Use           Planned Development District Application ‐ Preliminary 18.67 $1710 plus $50 per lot $1770 plus $52 per lot $60.00 3.51% $2.00 4.00% Comm Dev Land Use           Planned Development District Application ‐ Final 18.67 $420 $435 $15.00 3.57% Comm Dev Land Use           Plat Alteration 17.09 & 17.12 $1,050 $1,087 $37.00 3.52% Comm Dev Land Use Reconsideration of quasi‐judicial decisions 18.80.140 &  20.09.070 $250 $259 $9.00 3.60% CommDev Land Use Revisions to approved Permits (50% of original fee)50% of original fee 50% of original fee Comm Dev Land Use Unmentioned Uses 18.51.020 $200 $207 $7.00 3.50% Comm Dev Land Use Vacation Rental 18.63 $370 $383 $13.00 3.51% Comm Dev Land Use Vacation Rental Annual Renewal 18.63 $105 $109 $4.00 3.81% Comm Dev Land Use Variance  17 & 18 $650 $673 $23.00 3.54% Comm Dev Land Use Waivers, Deferrals, Deviations (per)17.33 $200 $207 $7.00 3.50% Comm Dev Land Use Zone Change 18.81.010 $1,050 $1,087 $37.00 3.52% Comm Dev Land Use Zoning Verification Letter 18.03 $75 NEW Comm Dev Development Engineering Engineering Plan Review ‐ by City Staff 18.10.030 $400, $100 for each add'l  sheet $414 (for first 4 pages),  $104 for each add'l  sheet $14.00 3.50%transferred from Public Works Comm Dev Building Permit Building Permit ‐ Per Foot Valuation 16.02.070 Per IBC Schedule Per IBC Schedule Comm Dev Building Permit Build on Unplatted Property 16.02.040 $300 $311 $11.00 3.67% Comm Dev Building Permit After Hours Inspection (2 hr. Minimum)16.02 $75 $78 $3.00 4.00% Comm Dev Building Permit Demo Permit 16.08 $210 $217 $7.00 3.33% Comm Dev Building Permit Fence Permit 12.28 $30 $35 $5.00 16.67% Comm Dev Building Permit Fence Permit (7' High or Higher)12.28 $63 $65 $2.00 3.17% Comm Dev Building Permit Grading, Parking Lots and/or Stormwater permits 18.54.100 $105 $109 $4.00 3.81% Comm Dev Building Permit Mechanical Permit 16.02 $50.00 + $10 Per Unit $52.00 + $11 Per Unit $2.00 4.00% $1.00 10.00% Comm Dev Building Permit Mobile Home Placement 18.6 $350 $362 $12.00 3.43% Comm Dev Building Permit Plumbing Permit 16.02 $50.00 + $10.00 Per  Fixture $52.00 + $11 Per Unit $2.00 4.00% $1.00 10.00% Comm Dev Building Permit Sign Permit 18.58 Per IBC Schedule Per IBC Schedule Comm Dev Building Permit Solar Install 16.02 $125 $129 $4.00 3.20% Comm Dev Building Permit Storage Container Placement (per container)18.76 $100 $105 $5.00 5.00% Comm Dev Building Permit Technical Fee on all building permits Via Ordinance 1.00%1.00% Codes Description Garbage Tags 8.08.140 $3.34 $3.34 GB005 Residential 1st 96 Gallon Cart 8.08.140 $37.12 $37.12 GB006 Residential 1st 64 Gallon Cart 8.08.140 $24.75 $24.75 GB007 Residential 1st 48 Gallon Cart 8.08.140 $22.68 $22.68 GB015 Senior 1st 96 Gallon Cart 8.08.140 $18.57 $18.57 GB016 Senior 1st 64 Gallon Cart 8.08.140 $12.38 $12.38 GB017 Senior 1st 48 Gallon Cart 8.08.140 $11.34 $11.34 GB025 Delivery 2nd Cart 8.08.140 $7.32 $7.32 GB030 Cart Removal/Exchange 8.08.140 $14.67 $14.67 GB150 (2)Commercial 48 Gallon Cart 1 Time a Week 8.08.140 $15.08 $15.08 GB151 (2)Commercial 48 Gallon Cart 2 Times a Week 8.08.140 $23.64 $23.64 GB155 Commercial 64 Gallon Cart 1 Time a Week 8.08.140 $22.31 $22.31 GB160 Commercial 64 Gallon Cart 2 Times a Week 8.08.140 $36.73 $36.73 GB165 Commercial 96 Gallon Cart 1 Time a Week 8.08.140 $29.53 $29.53 GB170 Commercial 96 Gallon Cart 2 Times a Week 8.08.140 $51.43 $51.43 GB175 Commercial 96 Gallon Cart Extra Pickup 8.08.140 $15.13 $15.13 GB200 1 Yard Dumpster 1 Time a Week 8.08.140 $47.73 $47.73 GB210 1 Yard Dumpster 2 Times a Week 8.08.140 $84.45 $84.45 GB215 1 Yard Dumpster 3 Times a Week 8.08.140 $119.76 $119.76 GB218 1 Yard Dumpster 5 Times a Week 8.08.140 $159.09 $159.09 GB220 Extra Pickup 1 Yard Dumpster 8.08.140 $60.60 $60.60 GB225 1.5 Yard Dumpster 1 Time a Week 8.08.140 $65.32 $65.32 GB230 1.5 Yard Dumpster 2 Times a Week 8.08.140 $114.51 $114.51 GB235 1.5 Yard Dumpster 3 Times a Week 8.08.140 $163.91 $163.91 GB240 Extra Pickup 1.5 Yard Dumpster 8.08.140 $61.78 $61.78 GB245 2 Yard Dumpster 1 Time a Week 8.08.140 $78.57 $78.57 GB250 2 Yard Dumpster 2 Times a Week 8.08.140 $137.52 $137.52 GB255 2 Yard Dumpster 3 Times a Week 8.08.140 $196.89 $196.89 GB260 2 Yard Dumpster 4 Times a Week 8.08.140 $256.81 $256.81 GB265 2 Yard Dumpster 5 Times a Week 8.08.140 $318.73 $318.73 GB270 Extra Pickup 2 Yard Dumpster 8.08.140 $63.04 $63.04 GB275 3 Yard Dumpster 1 Time a Week 8.08.140 $108.85 $108.85 GB280 3 Yard Dumpster 2 Times a Week 8.08.140 $190.75 $190.75 GB285 3 Yard Dumpster 3 Times a Week 8.08.140 $273.22 $273.22 GB287 3 Yard Dumpster 4 Times a Week 8.08.140 $359.21 $359.21 GB288 3 Yard Dumpster 5 Times a Week 8.08.140 $452.78 $452.78 GB290 Extra Pickup 3 Yard Dumpster 8.08.140 $88.59 $88.59 GB295 4 Yard Dumpster 1 Time a Week 8.08.140 $135.38 $135.38 GB300 4 Yard Dumpster 2 Times a Week 8.08.140 $262.07 $262.07 GB310 4 Yard Dumpster 3 Times a Week 8.08.140 $372.06 $372.06 GB315 4 Yard Dumpster 4 Times a Week 8.08.140 $484.56 $484.56 GB320 4 Yard Dumpster 5 Times a Week 8.08.140 $601.48 $601.48 GB325 Extra Pickup 4 Yard Dumpster 8.08.140 $110.10 $110.10 GB330 6 Yard Dumpster 1 Time a Week 8.08.140 $187.15 $187.15 GB335 6 Yard Dumpster 2 Times a Week 8.08.140 $357.05 $357.05 GB340 6 Yard Dumpster 3 Times a Week 8.08.140 $525.50 $525.50 GB345 6 Yard Dumpster 4 Times a Week 8.08.140 $692.52 $692.52 GB350 6 Yard Dumpster 5 Times a Week 8.08.140 $858.08 $858.08 GB352 Extra Pickup 6 Yard Dumpster 8.08.140 $125.23 $125.23 GB355 8 Yard Dumpster 1 Time a Week 8.08.140 $256.27 $256.27 GB360 8 Yard Dumpster 2 Times a Week 8.08.140 $482.31 $482.31 GB365 8 Yard Dumpster 3 Times a Week 8.08.140 $705.46 $705.46 GB370 8 Yard Dumpster 4 Times a Week 8.08.140 $921.41 $921.41 GB375 8 Yard Dumpster 5 Times a Week 8.08.140 $1,130.17 $1,130.17 GB380 Extra Pickup 8 Yard Dumpster 8.08.140 $151.17 $151.17 GB390 Extra 1/2 Yard 8.08.140 $8.61 $8.61 GB395 Extra Bag, Box or Bundle 8.08.140 $4.00 $4.00 GB405 Temporary Delivery 2‐8 yard 8.08.140 $28.78 $28.78 GB420 Temporary 2 Yard Dumpster 8.08.140 $35.99 $35.99 GB425 Temporary 2 Yard Dumpster Rental 8.08.140 $6.12 $6.12 GB440 Temporary 4 Yard Dumpster 8.08.140 $57.59 $57.59 GB445 Temporary 4 Yard Dumpster Rental 8.08.140 $9.78 $9.78 GB460 Temporary 6 Yard Dumpster 8.08.140 $79.20 $79.20 GB465 Temporary 6 Yard Dumpster Rental 8.08.140 $12.41 $12.41 GB480 Temporary 8 Yard Dumpster 8.08.140 $101.38 $101.38 City of Moses Lake‐Solid Waste Rates Schedule A COML Council Packet 11-14-23, Page 264 of 277 DEPART FEE TYPE FEE DESCRIPTION MLMC Section 2023 Fee 2024 Proposed Fee Change in fee % Change GB485 Temporary 8 Yard Dumpster Rental 8.08.140 $15.00 $15.00 GB505 10 Yard Roll‐off 1 Time a Month 8.08.140 $439.12 $439.12 GB510 10 Yard Roll‐off Extra Pickup 8.08.140 $323.93 $323.93 GB515 10 Yard Roll‐off 1 Time a Week 8.08.140 $1,000.58 $1,000.58 GB520 20 Yard Roll‐off 1 Time a Month 8.08.140 $527.49 $527.49 GB525 20 Yard Roll‐off Extra Pickup 8.08.140 $376.46 $376.46 GB530 20 Yard Roll‐off 1 Time a Week 8.08.140 $1,150.83 $1,150.83 GB535 20 Yard Roll‐off 2 Times a Month 8.08.140 $749.70 $749.70 GB540 30 Yard Roll‐off 1 Time a Month 8.08.140 $634.54 $634.54 GB545 30 Yard Roll‐off Extra Pickup 8.08.140 $442.38 $442.38 GB550 30 Yard Roll‐off 1 Time a Week 8.08.140 $1,518.74 $1,518.74 GB555 30 Yard Roll‐off 2 Times a Week 8.08.140 $2,934.37 $2,934.37 GB560 30 Yard Roll‐off 2 Times a Month 8.08.140 $964.57 $964.57 GB565 40 Yard Roll‐off 1 Time a Month 8.08.140 $932.86 $932.86 GB570 40 Yard Roll‐off Extra Pickup 8.08.140 $505.08 $505.08 GB575 40 Yard Roll‐off 1 Time a Week 8.08.140 $1,707.45 $1,707.45 GB577 40 Yard Roll‐off 2 Times a Week 8.08.140 $3,414.81 $3,414.81 GB580 Temporary Delivery 10‐40 yd 8.08.140 $58.05 $58.05 GB585 Temporary Rent 8.08.140 $43.53 $43.53 GB595 2 Yard Compactor 1 Time a Week 8.08.140 $173.50 $173.50 GB600 2 Yard Compactor Extra Pickup 8.08.140 $88.59 $88.59 GB605 10 to 15 Yard Compactor 1 Time a Week 8.08.140 $1,209.08 $1,209.08 GB610 10 to 15 Yard Compactor 1 Time a Month 8.08.140 $385.93 $385.93 GB615 10 to 15 Yard Compactor 2 Times a Month 8.08.140 $699.63 $699.63 GB620 10 to 15 Yard Compactor Extra Pickup 8.08.140 $360.53 $360.53 GB625 16 to 20 Yard Compactor 1 Time a Week 8.08.140 $1,747.22 $1,747.22 GB630 16 to 20 Yard Compactor 1 Time a Month 8.08.140 $481.03 $481.03 GB635 16 to 20 Yard Compactor Extra Pickup 8.08.140 $442.10 $442.10 GB640 21 to 30 Yard Compactor 1 Time a Month 8.08.140 $563.54 $563.54 GB645 21 to 30 Yard Compactor Extra Pickup 8.08.140 $468.89 $468.89 GB650 21 to 30 Yard Turn Around 1 Time a Month 8.08.140 $622.60 $622.60 GB655 21 to 30 Yard Turn Around Extra Pickup 8.08.140 $527.96 $527.96 GB660 31 to 40 Yard Compactor 1 Time a Month 8.08.140 $719.84 $719.84 GB665 31 to 40 Yard Compactor Extra Pickup 8.08.140 $489.50 $489.50 GB670 30 Cans Downtown 8.08.140 $207.32 $207.32 GB680 Garbage Comm 21‐30Yd Comp 1xWk 8.08.140 $2,370.91 $2,370.91 GB685 Garbage Comm 21‐30Yd Comp 2xWk 8.08.140 $4,741.85 $4,741.85 GB710 15 Minutes Manpower 8.08.140 $21.34 $21.34 GB720 15 Minutes Truck 8.08.140 $28.18 $28.18 GB730 Return Trip 8.08.140 $13.34 $13.34 GB900 REC Garb Haul 25 Yd 8.08.140 $254.18 $254.18 GB910 REC Garb 25 Yd Single Swap 8.08.140 $74.39 $74.39 GB920 REC Garb 25 Yd Double Swap 8.08.140 $111.60 $111.60 GB940 REC Garb Overtime to Contractor 8.08.140 $39.74 $39.74 RGB005 96 Gallon Cart replacement 8.08.140 $71.34 $71.34 RGB006 64 Gallon Cart replacement 8.08.140 $64.65 $64.65 RGB007 48 Gallon Cart replacement 8.08.140 $61.31 $61.31 RGBLID Cart Lid replacement 8.08.140 $22.29 $22.29 Nonconforming services will be billed at the nearest higher rate shown in the above schedule for the type of service rendered.  Commercial accounts may pick any combination or quantity of services shown in the above and be billed on one account.  Yardage or landfill charge ‐ special service amount charged at landfill multiplied by 1.50. (1) Bill Code eliminated. Just use applic (2) Eliminating commercial can service‐ Replacing with commercial 48 gallon COML Council Packet 11-14-23, Page 265 of 277 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 AB C DE City of Moses Lake 2024 Fee Schedule Accepted by:Resolution 3966 Nov 14 2023 DEPART FEE TYPE FEE DESCRIPTION MLMC Section 2024 Fee Citywide Administrative Copy charge-per page RCW 42.56.120 $0.15 Citywide Administrative Scan to electronic format-per page (8-1/12x11 one side) RCW 42.56.120 $0.10 Citywide Administrative Every 4 files or attachments provided electronically RCW 42.56.120 $0.05 Citywide Administrative Each gigabyte of electronic records transmission RCW 42.56.120 $0.10 Citywide Administrative Storage media, container, envelope; postage/delivery RCW 42.56.120 Actual Cost Citywide Administrative Maps and oversized document scanning or printing (per page)$5.00 Citywide Administrative Custom data requests (per hour) RCW 42.56.120 $50.00 Citywide Administrative CD/DVD copy - per media RCW 42.56.120 $1.00 Citywide Administrative Return check charge $35.00 Citywide Administrative Facility Rental Application Processing Fee $25.00 Citywide Administrative Facility Rental Type 2 Mon-Fri 8am-5pm (per hour, 2-hour minimum)$30.00 Citywide Administrative Facility Rental Type 2 after 5pm and Saturdays (per hour, 2-hour minimum)$70.00 Citywide Administrative Facility Rental Type 3 Mon-Fri 8am-5pm (per hour, 2-hour minimum)$75.00 Citywide Administrative Facility Rental Type 3 after 5 pm and Saturdays (per hour, 2-hour minimum)$100.00 Citywide Administrative Facility – Café/Kitchen Rental (per day) $50.00 Citywide Administrative Facility – Six Foot Table Rental (per day) $10.00 Citywide Administrative Facility – A-V Equipment Use (per day) $25.00 Citywide Administrative Facility – IT set up & instructions on basic equipment use (per hour)$150.00 Citywide Administrative Facility – Custodian Services Clean-Up Overtime Rate (per hour)$50.00 Citywide Administration Concessionaire agreement on City Property-Non-Profit organization 10% of Gross Revenue Citywide Administration Concessionaire agreement on City Property-For-Profit entity 15% of Gross Revenue Citywide Administrative Hearing Examiner Admin. Appeals-rate per hour. 1.20.120 $175 Citywide Administrative Online services (bill pay, application, activity, etc.) convenience fee Cost recovery actual POLICE Administrative Reports (incl accident) (per page) RCW42.56.120 $0.15 POLICE Administrative Photos (per photo) RCW42.56.120 $0.15 POLICE Administrative DVD/CD copy per media (per DVD/CD) RCW42.56.120 $1.00 POLICE Administrative Criminal History 5.02.020 $20.00 POLICE Administrative Fingerprinting 5.02.020 $15.00 POLICE Administrative Dog Lic. Annual 6.04.030 $10.00 POLICE Administrative Dog Lic. Replacement 6.04.030 $5.00 POLICE Administrative potentially dangerous Dog Lic. 6.10.110 $100.00 POLICE Administrative Dangerous Dog License 6.10.110 $300.00 POLICE Administrative Bike License no fee POLICE Administrative Concealed pistol license RCW 9.41.070 $49.25 POLICE Administrative CPL Fingerprinting RCW 9.41.070 $32.00 POLICE Administrative CPL late renewal RCW 9.41.070 $42.00 POLICE Administrative Thumb Drive RCW42.56.120 $10.00 Fire Administrative conference room use 1/2 room (up to 50 occupants) (per hour) $21.00 Fire Administrative Local, State, Federal Government fee for cleaning / maintenance $27.00 Fire Administrative City of Moses Lake sponsored events no fee Fire Administrative Ambulance Report $7.25 Fire Permit (Hazardous material) 1 Class 16.40.030 $170.75 Fire Permit (Hazardous material) 2 Classes 16.40.030 $284.60 Fire Permit (Hazardous material) 3 Classes 16.40.030 $434.70 Fire Permit (Hazardous material) 4 Classes or more than 4,000 gallons, 19,000 cubic feet, or 249,000 pounds of any single class 16.40.030 $574.00 Fire Permit (Hazardous material) 5 Classes or more than 5,000 gallons, 25,000 cubic feet, or 280,000 pounds of any single class 16.40.030 $740.00 Fire Permit (Hazardous material) Extremely Hazardous Substances, highly toxic, toxic, & pyrophoric materials of any amount 16.40.030 $1,141.10 Fire Permit (Hazardous material) Marijuana Extraction Systems/ Facilities 16.40.030 $713.10 Fire Permit (Hazardous material) Temporary membrane structures and tents exceeding 400 square feet 16.40.030 $171.80 COML Council Packet 11-14-23, Page 266 of 277 3 AB C DE DEPART FEE TYPE FEE DESCRIPTION MLMC Section 2024 Fee 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 Fire Operational Permit Aviation Facilitates, Commercial Repair Operations, Heliports, Helistops & Fueling Facilities 16.40.030 $284.60 Fire Operational Permit Carnivals and Fairs 16.40.030 $170.75 Fire Operational Permit Combustible Dust producing operations 16.40.030 $200.80 Fire Operational Permit Dry Cleaning Plants using flammable solvents 16.40.030 $172.85 Fire Operational Permit Exhibits/ Trade Shows 16.40.030 $172.85 Fire Operational Permit High Piled Combustible Storage 16.40.030 $341.55 Fire Operational Permit Hot work operations 16.40.030 $142.80 Fire Operational Permit Hot work program 16.40.030 $200.80 Fire Operational Permit Industrial Oven 16.40.030 $683.10 Fire Operational Permit Lumber Yards 16.40.030 $170.75 Fire Operational Permit Battery systems having a liquid capacity of more than 50 gallons 16.40.030 $284.60 Fire Permit Fire protection systems, industrial process equipment regulated by the fire code, LPG, Natural gas, flammable and combustible liquid dispensing/distribution system and installation of private fire hydrant: 16.40.030 Fire Permit $1 to $500 16.40.030 $56.90 Fire Permit $501 to $2,000- $55.00 for the first $500 Plus $6.60 for each additional $100 or fraction thereof, to and including $2,000 16.40.030 $56.90 16.40.030 $6.83 Fire Permit $2,001 to $25,000- $154 for the first $2,000 Plus $31.00 for each additional $1,000 or fraction thereof, to and including $25,000 16.40.030 $159.35 16.40.030 $32.00 Fire Permit $25,001 to $50,000- $711 for the first $25,000 Plus $85.00 for each additional $1,000 or fraction thereof, to and including $50,000 16.40.030 $735.85 16.40.030 $87.95 Fire Permit $50,001 and above 2.5% of project value 16.40.030 Fire Permit Private Fire Hydrant"s" each hydrant 16.40.030 $142.80 Fire Permit Fire Department Radio Coverage System 16.40.030 $714.15 Fire Plan Check Technology Fee -Project Value $2001 and above 16.40.030 $170.75 Fire Permit - Special Event Fireworks / pyrotechnic displays:16.40.030 $211.15 Fire Permit - Demolition Demolition of required Fire Protection System or Fire Alarm System: 16.40.030 $177.00 Fire Permit UST/AGT Decommissioning of flammable / combustible liquid tanks: up to 1100 gallon capacity 16.40.030 $177.00 Fire Permit UST/AGT Decommissioning of flammable / combustible liquid tanks: 1101- 10,000 gallon capacity 16.40.030 $341.55 Fire Permit UST/AGT Decommissioning of flammable / combustible liquid tanks: 10,000 gallon capacity and above 16.40.030 $626.15 Fire Plan Check Plan review fees - (% of total permit fee)16.40.030 70.00% Fire Plan Check 3rd Party Review Cost Recover actual costs + technology 16.40.030 Cost Recovery actual Fire Special Inspections Special / Technical Inspections - Cost Recovery actual costs 16.40.030 Cost Recovery actual Fire False Alarms 3 False Alarms in any 3 month period:8.26.30 $218.35 Fire False Alarms 4 or more false alarms in 3 months (per response)8.26.30 $745.20 Fire MVA / Hazmat Supply recovery for foam, absorbents, or other materials - Cost recovery actual costs utilized to mitigate hazards CFR and RCW Cost Recovery Actual Fire Operational Permit Hazardous Materials Super User category (Mandatory SARA Title III Tier II reporter / mandatory facility action plan required) 16.40.030 $2,375.15 Fire Operational Permit Mobile Food Vehicle Annual Permit $50.00 Fire Operational Permit Energy Storage System other than lead acid battery systems.$284.60 Fire Re-inspection Fee Charged on the 3rd inspection visit without compliance $75.00 Fire Operational Permit Refrigeration systems above 5,000 pounds refrigerant $125.00 Fire Fire Impact Fees Deferred Impact Administration-nte 20/yr.-per request 21.03.030(f) $85.00 Fire Fire Impact Fees Independent Calculation per request 21.030.050(a) $100.00 Fire Fire Impact Fees Single and Two Family Residential development $420+$21.04 Non refundable administrative cost per unit 21.03.170-180 $441.89-$462.93 Fire Fire Impact Fees Multi-Family initial $420+$21.04 Non refundable administrative cost per unit 21.03.170-180 $441.89+ COML Council Packet 11-14-23, Page 267 of 277 3 AB C DE DEPART FEE TYPE FEE DESCRIPTION MLMC Section 2024 Fee 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 Fire Fire Impact Fees Hospitals and Clinics- which includes a non-refundable administrative fee of $.0365 per square foot 21.03.170-180 (per Square foot) $0.7665 Fire Fire Impact Fees Skilled Nursing and Licensed Care Facilities-which includes a non- refundable administrative fee of $.0365 per square foot 21.03.170-180 (per Square foot) $0.7665 Fire Fire Impact Fees Hotel-Motel Development- which includes a non-refundable administrative fee of $.013 per square foot 21.03.170-180 (per Square foot) $0.273 Fire Fire Impact Fees Office Development-which includes a non-refundable administrative fee of $.0035 per square foot 21.03.170-180 (per Square foot) $0.0735 Fire Fire Impact Fees Retail Development-which includes a non-refundable administrative fee of $.0035 per square foot 21.03.170-180 (per Square foot) $0.0735 Fire Fire Impact Fees Industrial Development with no connected suppression water storage on site-which includes a non-refundable administrative fee of $.005 per square foot 21.03.170-180 (per Square foot) $0.105 Fire Fire Impact Fees Industrial Development with full fire flow suppression water storage on site-which includes a non-refundable administrative fee of $.0035 per square foot 21.03.170-180 (per Square foot) $0.0735 Fire Fire Impact Fees Restaurants-which includes a non-refundable administrative fee of $.0015 per square foot 21.03.170-180 (per Square foot) $0.0315 Fire Fire Impact Fees Churches-which includes a non-refundable administrative fee of $.001 per square foot 21.03.170-180 (per Square foot) $0.021 Fire Fire Impact Fees Education Development-which includes a non-refundable administrative fee of $.001 per square foot 21.03.170-180 (per Square foot) $0.021 Ambulance Transport Rate--BLS Basic Life Support Transport Fee 2.30.050 $1,029.00 Ambulance Transport Rate--ALS Advanced Life Support Transport Fee 2.30.050 $1,181.25 Ambulance Transport Rate--BLS Non-Resident BLS Transport Fee 2.30.050 $1,235.00 Ambulance Transport Rate--ALS Non-Resident ALS Transport Fee 2.30.050 $1,326.00 Ambulance Mileage Mileage fee for patient transport (loaded miles) 2.30.050 $18.47 Ambulance Treatment w/ out transport Non-resident on scene patient treatment / care without transport.2.30.050 $305.00 Ambulance Treatment w/ out transport On scene patient treatment / care without transport. 2.30.050 $271.69 Ambulance School Dist. Athletic Standby Ambulance Standby for scheduled School District - Cost Recovery Athletic Events (per event)2.30.050 Cost Recovery Ambulance Utility Rate Indexing CPI Adjustment for Ambulance Utility per Utility account (rounded to closest $.05) 2.30.110 $17.20 Ambulance Non-residential Utility Fees Square Foot Fee for non-residential structures - 1 Additional utility fee per 5,000 square feet or portion thereof to a maximum of 25. 2.30.120 No change to current methodology Ambulance Lodging Utility Fees Utility fee structure for hotels / motels - 1/2 of total room count shall be charged a per room utility fee 2.30.120 No change to current methodology Ambulance Committed EMS Standby Standby time for non-profit events (per hour, 1 hr. min) 2.30.50 Cost Recovery Ambulance Committed EMS Standby Standby time for profit events: cost per hour (per hour, 2hr min) 2.30.50 Cost Recovery Ambulance Healthcare Education CPR / AED training--layperson - Cost recovery for course material 2.30.50 Cost Recovery Ambulance Healthcare Education CPR / Aed training--professional rescuer /healthcare (per student) 2.30.50 $59.75 Parks Administrative Past due invoice late fee (Assessed @ 30 days past due & each successive 30-day period until paid) 1% of past due balance Parks Recreation Youth -Per player fee - practice(baseball/softball/soccer)3.34.010 $7.00 Parks Recreation Youth -Per player fee - League(baseball/softball/soccer)3.34.010 $12.00 Parks Recreation Adult - Per player fee - practice (baseball/softball/soccer)3.34.010 $9.00 Parks Recreation Adult - Per player fee - League (baseball/softball/soccer)3.34.010 $20.00 Parks Maintenance Picnic Table/Bench (each-applicable to Special Events)3.34.010 $21.00 Parks Maintenance Garbage Can (each-applicable to Special Events)3.34.010 $11.00 Parks Recreation Surf 'n Slide Daily Admission (per person)3.34.010 $5-$19 Parks Recreation Surf 'n Slide 10 Punch Card (per person)3.34.010 $90-$180 Parks Recreation Surf 'n Slide Picnic Shelter (per hour)3.34.010 $22.00 Parks Recreation Surf 'n Slide Senior Season Pass In-City (per person)3.34.010 $76.00 Parks Recreation Surf 'n Slide Senior Season Pass Out-of-City (per person)3.34.010 $87.00 Parks Recreation Surf 'n Slide Senior Season Pass In-City Pre-Season (per person) 3.34.010 $71.00 Parks Recreation Surf 'n Slide Senior Season Pass Out-of-City Pre-Season (per person) 3.34.010 $82.00 Parks Recreation Surf 'n Slide Adult Season Pass In-City (per person)3.34.010 $82.00 Parks Recreation Surf 'n Slide Adult Season Pass Out-of-City (per person)3.34.010 $93.00 COML Council Packet 11-14-23, Page 268 of 277 3 AB C DE DEPART FEE TYPE FEE DESCRIPTION MLMC Section 2024 Fee 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 Parks Recreation Surf 'n Slide Adult Season Pass In-City Pre-Season (per person) 3.34.010 $76.00 Parks Recreation Surf 'n Slide Adult Season Pass Out-of-City Pre-Season (per person) 3.34.010 $87.00 Parks Recreation Surf 'n Slide Youth Season Pass In-City (per person)3.34.010 $76.00 Parks Recreation Surf 'n Slide Youth Season Pass Out-of-City (per person)3.34.010 $87.00 Parks Recreation Surf 'n Slide Youth Season Pass In-City Pre-Season (per person) 3.34.010 $71.00 Parks Recreation Surf 'n Slide Youth Season Pass Out-of-City Pre-Season (per person) 3.34.010 $82.00 Parks Recreation Surf 'n Slide Child Season Pass In-City (per person)3.34.010 $41.00 Parks Recreation Surf 'n Slide Child Season Pass Out-of-City (per person)3.34.010 $49.00 Parks Recreation Surf 'n Slide Child Season Pass In-City Pre-Season (per person) 3.34.010 $39.00 Parks Recreation Surf 'n Slide Child Season Pass Out-of-City Pre-Season (per person) 3.34.010 $44.00 Parks Recreation Group Swim Lessons - All Levels 3.34.010 $42.00 Parks Recreation Surf 'n Slide Body Boarding Lessons - Flowrider 3.34.010 $52.00 Parks Recreation Surf 'n Slide Flowboarding Lessons - Standup 3.34.010 $52.00 Parks Recreation Surf 'n Slide Private Rental 1 - 100 Patrons (per hour)3.34.010 $1,126.00 Parks Recreation Surf 'n Slide Private Rental 101 - 150 Patrons (per hour)3.34.010 $1,210.00 Parks Recreation Surf 'n Slide Private Rental 151 - 250 Patrons (per hour)3.34.010 $1,380.00 Parks Recreation Surf 'n Slide Private Rental 251 - 500 Patrons (per hour)3.34.010 $1,628.00 Parks Recreation Surf 'n Slide Private Rental 501 - 1000 Patrons (per hour)3.34.010 $1,803.00 Parks Recreation Surf 'n Slide - Semi-private Lessons - All Levels 3.34.010 $120.00 Parks Recreation Surf 'n Slide - Private Lessons - All Levels 3.34.010 $240.00 Parks Recreation Lifeguard Certification Class 3.34.010 $175.00 Parks Admin Picnic Shelter Rental - 4 Hours 3.34.010 $57-$78 Parks Admin Picnic Shelter Rental - 8 Hours 3.34.010 $83-$104 Parks Admin Special Event Application Fee 12.36.065 $75-$175 Parks Administrative Special Event-Vendor Fee-For Profit 12.36.065 $50 per day Parks Admin Special Event-Vendor Fee-Non-Profit 12.36.065 $35 per day Parks Administrative Vendor-Seasonal-Roaming-(Ice Cream Truck)12.36.065 $100 per month Parks Recreation/Museum Museum classes and programs - to be determined by class size & supplies 3.34.010 Parks Recreation Parks/Recreation Programs - to be determined by class size & supplies 3.34.010 Parks Recreation Recreational sports leagues - to be determined by class size & supplies 3.34.010 Parks Recreation Ice Skating Admission (per person)3.34.010 $3-9$ Parks Recreation Ice Skating Admission Punch card 3.34.010 $40-$80 Parks Recreation Ice Skate Rental (per person)3.34.010 $4.00 Parks Recreation Ice Skating Admission Punch card with Skates 3.34.010 $40-$110 Parks Recreation Ice Skating Season Pass (Individual) no Skates 3.34.010 $16-$50 Parks Recreation Ice Skating Season Pass (Individual) with Skates 3.34.010 $48-$82 Parks Recreation winter ice program - to be determined by class size & supplies 3.34.010 $9 -$200 Parks Recreation Ice Rink Private Rental (per hour)3.34.010 $131-$249 Parks Maintenance Softball Field Use (per game)3.34.010 $23Y/$28A/$40 Schools Parks Maintenance Baseball Field Use (per game)3.34.010 $28Y/$38A/$50 Schools Parks Maintenance Soccer Field Use (per game)3.34.010 $20Y/$25A/$35 HS+ Schools Parks Maintenance Softball Field Lighting (per hour)3.34.010 $15.00 Parks Maintenance Soccer Field Lighting (per hour)3.34.010 $12.00 Parks Maintenance Baseball Field Lighting (per hour)3.34.010 $18.00 Parks Recreation Baseball/Softball Tournament Application Fee 3.34.010 $125.00 Parks Maintenance Baseball/Softball Crowd Fencing (per event)3.34.010 $175.00 Parks Admin Modifications 3.34.010 $5.00 - $25.00 Parks Maintenance Baseball/Softball Temporary Field Fencing 3.34.010 $80.00 Parks Maintenance Tennis Court Lighting 3.34.010 $1.75 for 50 mins Parks Administrative Cascade Campground Tent Site 3.34.010 $37.00 Parks Administrative Cascade Campground Tent Site Processing Fee 3.34.010 $7.00 Parks Administrative Cascade Campground RV Site 3.34.010 $42.00 Parks Administrative Cascade Campground RV Site Processing Fee 3.34.010 $7.00 Parks Administrative Cascade Campground Group Site 3.34.010 $228.00 COML Council Packet 11-14-23, Page 269 of 277 3 AB C DE DEPART FEE TYPE FEE DESCRIPTION MLMC Section 2024 Fee 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 Parks Administrative Cascade Campground Group Site Processing Fee 3.34.010 $50.00 Parks Administrative Cancellation Processing Fee (Campsite/Picnic Shelter)3.34.010 $15.00 Parks Maintenance Cascade Campground Showers 3.34.010 $0.50 - $3.75 Parks Administrative Amphitheater Rental (Daily)3.34.010 $104.00 Parks General Rental Attendant 3.34.010 $30.00 per hour Parks Recreation Community Garden Plot Rental (16-80 sq. ft.)3.34.010 $12.00 Parks Recreation Community Garden Plot Rental (81-160 sq. ft.)3.34.010 $23.00 Parks Recreation Community Garden Plot Rental (161-280 sq. ft.)3.34.010 $28.00 Parks Recreation Community Garden Plot Rental (281-512 sq. ft.)3.34.010 $34.00 Parks Maintenance Roto-tilling garden plots (per lot size)3.34.010 $12/$23/$28/$34 Parks Museum & Art Center Museum & Art Center Membership (Jackrabbit)$1.00-24.01 Parks Museum & Art Center Museum & Art Center Membership (Rattlesnake)$25.00 Parks Museum & Art Center Museum & Art Center Membership (Rainbow Trout)$40.00 Parks Museum & Art Center Museum & Art Center Membership (Coyote)$75.00 Parks Museum & Art Center Museum & Art Center Membership (Bald Eagle)$250.00 Parks Museum & Art Center Museum & Art Center Membership (Wild Horses)$500.00 Parks Museum & Art Center Museum & Art Center Membership (Great Blue Heron)$1,000.00 Parks Museum & Art Center Museum & Art Center Membership (Columbian Mammoth) $5,000.00 Parks Museum & Art Center Museum Field Trips $5.00 per person Parks Museum & Art Center Museum School Outreach Program $3 per Student Parks Museum & Art Center Museum Rental-Non Profit $150.00 per hour Parks Museum & Art Center Museum Rental-For Profit $297.12 per hour Parks Museum & Art Center Commission for Museum Consignments 30% to the Museum Parks Recreation Adopt-A-Street Application Fee 3.34.010 $50.00 Parks Larson Recreation Center Adult Annual Pass 3.34.010 $403.00 Parks Larson Recreation Center Adult 6-Month Pass 3.34.010 $229.00 Parks Larson Recreation Center Adult Monthly Pass 3.34.010 $41.00 Parks Larson Recreation Center Adult Daily Pass 3.34.010 $6.00 Parks Larson Recreation Center Adult Punch Card (12)3.34.010 $54.00 Parks Larson Recreation Center Teen & Seniors Annual Pass 3.34.010 $309.00 Parks Larson Recreation Center Teen & Seniors 6-month Pass 3.34.010 $182.00 Parks Larson Recreation Center Teen & Seniors Monthly Pass 3.34.010 $32.00 Parks Larson Recreation Center Teen & Seniors Daily Pass 3.34.010 $5.00 Parks Larson Recreation Center Teen & Seniors Punch Card Pass (12)3.34.010 $32.00 Parks Larson Recreation Center Youth Annual Pass 3.34.010 $168.00 Parks Larson Recreation Center Youth 6-month Pass 3.34.010 $98.00 Parks Larson Recreation Center Youth Monthly Pass 3.34.010 $18.00 Parks Larson Recreation Center Youth Daily Pass 3.34.010 $4.00 Parks Larson Recreation Center Youth Punch Card Pass (12)3.34.010 $27.00 Parks Larson Recreation Center Sage Room Rental- Non Profit -per hour 3.34.010 $45.00 Parks Larson Recreation Center Cascade Room Rental-Non Profit-per hour 3.34.010 $70.00 Parks Larson Recreation Center Lake Room Rental-Non Profit -per hour 3.34.010 $56.00 Parks Larson Recreation Center Cascade/Lake Room Rental- Non Profit-per hour 3.34.010 $84.00 Parks Larson Recreation Center Gymnasium Rental-Non Profit-per hour 3.34.010 $168.00 Parks Larson Recreation Center Kitchen Rental-Non Profit-per hour 3.34.010 $40.00 Parks Larson Recreation Center Damage Deposit-Non Profit-REFUNDABLE 3.34.010 $125.00 Parks Larson Recreation Center Damage Deposit with Alcohol-Non profit-REFUNDABLE 3.34.010 $500.00 Parks Larson Recreation Center Sage Room Rental-For Profit-per hour 3.34.010 $68.00 Parks Larson Recreation Center Cascade Room Rental-For Profit-per hour 3.34.010 $107.00 Parks Larson Recreation Center Lake Room Rental-For Profit-per hour 3.34.010 $86.00 Parks Larson Recreation Center Cascade/Lake Room Rental-For Profit-per hour 3.34.010 $137.00 Parks Larson Recreation Center Gymnasium Rental-For Profit-per hour 3.34.010 $333.00 Parks Larson Recreation Center Kitchen Rental-For Profit-per hour 3.34.010 $56.00 Parks Larson Recreation Center Damage Deposit-For Profit-REFUNDABLE 3.34.010 $200.00 Parks Larson Recreation Center Damage Deposit With Alcohol-For Profit-REFUNDABLE 3.34.010 $500.00 Parks Larson Recreation Center Application Fee- Non refundable 3.34.010 $25.00 Parks Larson Recreation Center Gym Rental for Athletic Practices-per hour 3.34.010 $55.00 Parks Larson Recreation Center LRC Pickleball/Badminton Court Rental-per hour/per court 3.34.010 $25.00 Parks Larson Recreation Center Birthday Party Package Ice Rink (1-10 participants) 2 hours 3.34.010 $220.00 Parks Larson Recreation Center Birthday Party Ice Rink Additional Participants-per participant 3.34.010 $22.00 Parks Larson Recreation Center Summer Student Membership-with current hs/College ID-100 day membership 3.34.010 $100.00 COML Council Packet 11-14-23, Page 270 of 277 3 AB C DE DEPART FEE TYPE FEE DESCRIPTION MLMC Section 2024 Fee 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 Parks Larson Recreation Center Roller Skating Admission (Discounted Days) (per person) 3.34.010 $2S/$2Y/$2A Parks Larson Recreation Center Roller Skating Admission (per person) 3.34.010 $5S/$5Y/$6A Parks Larson Recreation Center Roller Skate Rental -per session 3.34.010 $2.00 Parks Larson Recreation Center Birthday Party Package (Roller Rink) (1-10 participants) per session 3.34.010 $155.00 Parks Larson Recreation Center Roller Skate Rental -per hour 3.34.010 $125.00 Parks Larson Recreation Center Roller Skate Rental Additional Participants (includes skates) 3.34.010 $1-6/person Parks Compass Court - Food Truck Court Food Vendor Fee Per Day 3.34.010 $25.00 Parks Compass Court - Food Truck Court Non Food Vendor Fee Per Day 3.34.010 $10.00 Parks Compass Court - Food Truck Court Food Vendor Fee Per Day Special Event 3.34.010 $125.00 Parks Compass Court - Food Truck Court Non Food Vendor Fee Per Day Special Event 3.34.010 $50.00 Parks Compass Court - Food Truck Court Cleaning Fee Per Hour 3.34.010 $50.00 Finance Business License Bus License Fee - General, Resident & Non-Resident 5.04.080 Tiered rate based on number of employees (FTE). Finance Business License Tax-Exempt Non-Profit 5.04.080 $0.00 Finance Business License 1 through 5 Employees 5.04.080 $85/year Finance Business License 6 through 15 Employees 5.04.080 $155/year Finance Business License 16 through 50 Employees 5.04.080 $235/year Finance Business License 51 through 100 Employees 5.04.080 $445/year Finance Business License 101 or more Employees 5.04.080 $550/year Finance Business License Temporary Vendor 5.06.080 $25.00/90 days Finance Business License Mobile and Street Food Vendor 5.07.060 $25.00/90 days Finance Screening Fee Solicitors 5.02.010 $85.00 Finance Screening Fee Taxicabs 5.02.010 $85.00 Finance Screening Fee Application fee pawnbrokers/2nd hand dealer 5.16.030 $85.00 Finance Business License Bus. license fee - carnival 1st day 5.02.010 $155.00 Finance Business License - carnival 2nd day 5.16.030 $75.00 Finance Business License - carnival 3rd plus 5.16.030 $50.00 Finance Business License Bus. license fee - Circus 1st day 5.16.030 $155.00 Finance Business License - Circus 2nd day plus 5.16.030 $75.00 Finance Business License Bus license fee - Road show 1st day 5.16.030 $65.00 Finance Business License - Road show 2nd day plus 5.16.030 $35.00 Finance Business License Telecommunication license 5.50.030 $1,100.00 Finance Business License Telecommunication license - renewal 5.50.030 $550.00 Finance Business License Telecommunication franchise 5.50.030 $3,300.00 Finance Business License Telecommunication franchise - renewal 5.50.030 $1,650.00 Finance Business License Cable Franchise 5.50.030 $4,400.00 Finance Business License Cable Franchise - renewal 5.50.030 $2,200.00 Utility Solid Waste/Garbage Rates See Attachment A below 8.08.140 Utility Fixed Water Charge Single Family Residential .75" Meter 13.12.010 $24.83 Utility Fixed Water Charge Single Family Residential 1" Meter 13.12.010 $27.55 Utility Fixed Water Charge Single Family Residential 1.5" Meter 13.12.010 $35.78 Utility Fixed Water Charge Single Family Residential 2" Meter 13.12.010 $76.91 Utility Consumption Charge (per 100 cf)Single Family Tier 1 (0-1,000 cubic feet)13.12.010 $0.46 Utility Consumption Charge (per 100 cf)Single Family Tier 2 (1,001-3,000 cubic feet)13.12.010 $1.40 Utility Consumption Charge (per 100 cf)Single Family Tier 3 (over 3,000 cubic feet)13.12.010 $2.78 Utility Fixed Water Charge Duplex .75" Meter 13.12.035 $49.67 Utility Fixed Water Charge Duplex 1" Meter 13.12.015 $55.10 Utility Fixed Water Charge Duplex 1.5" Meter 13.12.015 $71.55 Utility Fixed Water Charge Duplex 2" Meter 13.12.015 $153.83 Utility Consumption Charge (per 100 cf)Duplex Tier 1 (0-2,000 cubic feet)13.12.015 $0.46 Utility Consumption Charge (per 100 cf)Duplex Tier 2 (2,001-6,000) cubic feet)13.12.015 $1.40 Utility Consumption Charge (per 100 cf)Duplex Tier 3 (over 6,000 cubic feet)13.12.015 $2.78 Utility Fixed Water Charge Multi-Family .75" Meter 13.12.020 $39.36 Utility Fixed Water Charge Multi-Family 1" Meter 13.12.020 $43.69 Utility Fixed Water Charge Multi-Family 1.5" Meter 13.12.020 $56.71 Utility Fixed Water Charge Multi-Family 2" Meter 13.12.020 $121.93 Utility Fixed Water Charge Multi-Family 3" Meter 13.12.020 $208.81 Utility Fixed Water Charge Multi-Family 4" Meter 13.12.020 $339.22 COML Council Packet 11-14-23, Page 271 of 277 3 AB C DE DEPART FEE TYPE FEE DESCRIPTION MLMC Section 2024 Fee 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 Utility Consumption Charge (per 100 cf)Multi-Family 13.12.020 $0.93 Utility Fixed Water Charge Commercial .75" Meter 13.12.020 $39.36 Utility Fixed Water Charge Commercial 1" Meter 13.12.020 $43.69 Utility Fixed Water Charge Commercial 1.5" Meter 13.12.020 $56.71 Utility Fixed Water Charge Commercial 2" Meter 13.12.020 $121.93 Utility Fixed Water Charge Commercial 3" Meter 13.12.020 $208.81 Utility Fixed Water Charge Commercial 4" Meter 13.12.020 $339.22 Utility Fixed Water Charge Commercial 6" Meter 13.12.020 $469.57 Utility Fixed Water Charge Commercial 8" Meter 13.12.020 $817.27 Utility Consumption Charge (per 100 cf)Commercial 13.12.020 $1.12 Utility Fixed Water Charge Irrigation .75" Meter 13.12.020 $39.36 Utility Fixed Water Charge Irrigation 1" Meter 13.12.020 $43.69 Utility Fixed Water Charge Irrigation 1.5" Meter 13.12.020 $56.71 Utility Fixed Water Charge Irrigation 2" Meter 13.12.020 $121.93 Utility Fixed Water Charge Irrigation 3" Meter 13.12.020 $208.81 Utility Fixed Water Charge Irrigation 4" Meter 13.12.020 $339.22 Utility Consumption Charge (per 100 cf)Irrigation Tier 1 (0-1,000 cubic feet) 13.12.020 $0.46 Utility Consumption Charge (per 100 cf)Irrigation Tier 2 (1,001-3,000 cubic feet) 13.12.020 $1.40 Utility Consumption Charge (per 100 cf)Irrigation Tier 3 (over 3,000 cubic feet) 13.12.020 $2.78 Utility Fixed Water Charge Industrial .75" Meter 13.12.020 $39.36 Utility Fixed Water Charge Industrial 1" Meter 13.12.020 $43.69 Utility Fixed Water Charge Industrial 1.5" Meter 13.12.020 $56.71 Utility Fixed Water Charge Industrial 2" Meter 13.12.020 $121.93 Utility Fixed Water Charge Industrial 3" Meter 13.12.020 $208.81 Utility Fixed Water Charge Industrial 4" Meter 13.12.020 $339.22 Utility Fixed Water Charge Industrial 6" Meter 13.12.020 $469.57 Utility Fixed Water Charge Industrial 8" Meter 13.12.020 $817.27 Utility Consumption Charge (per 100cf)Industrial 13.12.020 $1.12 Utility Fixed Sewer Charge Single Family Residential 13.12.030 $41.88 Utility Fixed Sewer Charge Duplex 13.12.035 $83.78 Utility Fixed Sewer Charge Multi-Family Unit (per unit)$11.82 Utility Fixed Sewer Charge Commercial 13.12.040 $44.94 Utility Consumption Charge (per 100cf)Commercial Sewer Consumption 13.12.040 $2.01 Utility Fixed Sewer Charge Industrial 13.12.040 $50.55 Utility Consumption Charge (per 100cf)Industrial Sewer Consumption 13.12.040 $2.22 Utility Stormwater Residential Residential 13.03.020 $7.11 Utility Stormwater Non-residential 0-6,000 sf impervious ground cover 13.03.020 $7.11 Utility Stormwater Non-residential 6,001-15,000 sf impervious ground cover 13.03.020 $12.01 Utility Stormwater Non-residential 15,001-30,000 sf impervious ground cover 13.03.020 $17.52 Utility Stormwater Non-residential 30,001-60,000 sf impervious ground cover 13.03.020 $34.92 Utility Stormwater Non-residential 60,001-120,000 sf impervious ground cover 13.03.020 $69.56 Utility Stormwater Non-residential 120,001-240,000 sf impervious ground cover 13.03.020 $139.19 Utility Stormwater Non-residential Over 240,000 sf impervious ground cover 13.03.020 $208.77 Utility Administrative After-Hour Service Charge 13.12.053 $100.00 Utility Administrative Late Payment Charge 13.12.085 *Minimum of $5 or 2% Utility Administrative Disconnect For Non-Payment $65.00 Utility Administrative Sign in Fee 13.12.085 $15.00 Utility Administrative Temporary Water Service Fee $25.00 Utility Administrative Return Trip Meter Service Fee $25.00 Utility Administrative Meter Bench Test $500.00 Utility Administrative Door Tag Fee $25.00 Utility Administrative Disconnection of Water for non-compliance with MLMC 13.07.06A to repair/stop water leak 13.07.06A $65.00 Utility Administrative Reconnection of Water for non-compliance with MLMC 13.07.06A to repair/stop water leak 13.07.06A $65.00 Utility Administrative Meter tamper fee 13.12 $250.00 Public Works Water main tapping fee 3/4" - 2" tap $170.62 Public Works Water main tapping fee 4" - 6" tap $382.54 Public Works Water main tapping fee 8" tap $464.04 Public Works Water main tapping fee 10" tap $589.02 Public Works Water main tapping fee 12" tap $682.48 Public Works Water sample Purity test per sample 13.05.110 $117.37 Public Works Filling and flushing Newly constructed water mains Per 100 ft of line 13.07.070 $28.26 Public Works water meter 3/4" meter 3.62.010 & .020 $411.88 Public Works water meter 1" meter 3.62.010 & .020 $517.29 Public Works water meter 1-1/2" meter 3.62.010 & .020 $1,000.90 Public Works water meter 2" meter 3.62.010 & .020 $1,058.49 COML Council Packet 11-14-23, Page 272 of 277 3 AB C DE DEPART FEE TYPE FEE DESCRIPTION MLMC Section 2024 Fee 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 Public Works Previously installed water srvc 3/4" service $2,353.90 Public Works Previously installed water srvc 1" service $3,531.94 Public Works Previously installed water srvc 1-1/2" to 2" service $4,708.89 Public Works Connect to existing main Any size (up to 4 hours)3.58.010 $430.35 Public Works Connect to existing main After 4 hours (ea. additional hr. w/ service truck & 2 workers (per hour) $217.35 Public Works Engineering inspector overtime Charge for working outside of normal hours (per hr.)$86.94 Public Works Assignment of Water Rights Domestic water rights charge per equivalent residential unit (ERU) when subdividing residential, commercial, and industrial real property. 1ERU = 0.6 ACRE FOOT of Water use. (per ERU min 1ERU per lot) 17.03.060 $2,173.50 Public Works Water System Development Chrg 3/4" water meter 3.62.010 $1,559.49 Public Works Water System Development Chrg 1" water meter 3.62.010 $2,649.50 Public Works Water System Development Chrg 1-1/2" water meter 3.62.010 $5,277.26 Public Works Water System Development Chrg 2" water meter 3.62.010 $8,474.48 Public Works Water System Development Chrg 3" water meter 3.62.010 $15,985.01 Public Works Water System Development Chrg 4" water meter 3.62.010 $31,964.58 Public Works Water System Development Chrg 6" water meter 3.62.010 $66,865.55 Public Works Water System Development Chrg 8" water meter 3.62.010 $126,399.89 Public Works Water System Development Chrg 10" water meter 3.62.010 $193,381.73 Public Works Sewer System Development Chrg 3/4" water meter 3.62.020 $930.26 Public Works Sewer System Development Chrg 1" water meter 3.62.020 $1,581.22 Public Works Sewer System Development Chrg 1-1/2" water meter 3.62.020 $3,134.19 Public Works Sewer System Development Chrg 2" water meter 3.62.020 $4,955.58 Public Works Sewer System Development Chrg 3" water meter 3.62.020 $9,488.41 Public Works Sewer System Development Chrg 4" water meter 3.62.020 $18,970.31 Public Works Sewer System Development Chrg 6" water meter 3.62.020 $39,546.83 Public Works Sewer System Development Chrg 8" water meter 3.62.020 $75,009.66 Public Works Sewer System Development Chrg 10" water meter 3.62.020 $114,820.57 Public Works Signage V-Lock Fee Fastener base for street signs. Contractor can purchase equal product elsewhere $38.04 Public Works Engineering Plan Review Administrative Fee Covers initial administrative processing costs for engineering plan submission. $80.00 per submission Public Works Engineering Plan Review Engineering Plan Review by 3rd Party (When required by Municipal Services Director) - $1000 deposit w/ Actual Cost Recovery* Actual Cost Recovery Public Works Stormwater Report Review Stormwater Report Review by City Staff ($400 deposit w/ Actual Cost Recovery) Actual Cost Recovery Public Works Street obstruction permit Inspection fee - 2.5% of construction costs, $50 min 3.54.010 $50 Min Public Works Sewer Discharge Permit New discharge permit application 13.05.170 $3,803.63 Public Works Sewer Discharge Permit Discharge permit renewal 13.05.170 $1,847.48 Public Works Sewer Discharge Permit Annual Discharge permit fee 13.05.170 $923.74 Public Works Stormwater Appeal Fee Pursuant to MLMC 1303.050 13.03.050 $59.77 Public Works hydrant rental Backflow Preventer (per day)13.09.060 $5.43 Public Works hydrant rental fire hydrant meter rental per day 13.12.090 $5.43 Public Works hydrant rental fire hydrant usage (per 100 cf)13.12.090 $1.07 Public Works hydrant rental fire hydrant rental with no city meter available - est. usage + 13.12.090 $8.69 Public Works Re-inspection Fee Work concealed without inspection or work not ready at the time of inspection will be charged a re-inspection fee $80.00 per trip Public Works Latecomer Contract Fee Fee for establishing a latecomer contract per MLMC 3.65.080. (resolution 3493, 1/27/2015) 3.65 $1,500.00 Public Works Technology Fee If not covered by IT Technology fee 1% COML Council Packet 11-14-23, Page 273 of 277 3 AB C DE DEPART FEE TYPE FEE DESCRIPTION MLMC Section 2024 Fee 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 Comm Dev Sidewalk Use Permits One time application fee of $150.00, each additional yearly fee 12.14 $83.00 Comm Dev Sidewalk Use Permits Sidewalk Use Fee and applicable leasehold taxes based on FMV upon license issuance (minimum fee $75.00)12.14 $75 min Comm Dev Land Use Annexation RCW 35A.14 $1,325 Comm Dev Land Use Appeals 20.11 $797 Comm Dev Land Use Code Interpretation 18.88.030 $78 Comm Dev Land Use Comp Plan Amendment - Text 19.55 $870 Comm Dev Land Use Comp Plan Amendment - Map 19.55 $1,087 Comm Dev Land Use Conditional Use Permit 19.55 $1,325 Comm Dev Land Use CRITICAL AREA PERMIT REVIEW: Comm Dev Land Use Aquifer Recharge Area 19.03.140 $311 Comm Dev Land Use Floodplain Development 19.03.150 $311 Comm Dev Land Use Geologically Hazardous Areas 19.03.160 Actual Cost Recovery Comm Dev Land Use Habitat Review 19.03.170 $311 Comm Dev Land Use Stream Buffers 19.03.170 $311 Comm Dev Land Use Wetlands 19.06 $311 Comm Dev Land Use Development Agreement 12.4 $1,739 Comm Dev Land Use ENVIRONMENTAL POLICY ACTIONS: Comm Dev Land Use Environmental Impact Statement (Recovery of all consultant costs will be billed in addition to the fee)14.06 $725 Comm Dev Land Use NEPA Review 14.06 $1,087 Comm Dev Land Use SEPA Review (time required is comparable to processing a subdivision application)14.06 $1,500 Comm Dev Land Use SEPA Co-Lead (per hour)14.06 $57 Comm Dev Land Use Hearing Examiner Charges-$400 deposit 18.8 Actual Cost Recovery Comm Dev Land Use Landscape Plan Review Fee (not submitted with subdivision) 18.57.050 $75.00 Comm Dev Land Use Landscape Plan Re-Review Fee (subdivision or other)18.57.050 $75.00 Comm Dev Land Use MULTIFAMILY TAX EXEMPTION FEES Comm Dev Land Use MFTE Application Base Fee 18.23 $280.00 Comm Dev Land Use MFTE County Assessor Pass through Fee 18.23.050 $350.00 Comm Dev Land Use MFTE Annual Monitoring Fee 18.23 $78.00 Comm Dev Land Use 8-year tax exemption request 18.23 $1,075.00 Comm Dev Land Use 12-year tax exemption request (affordable housing requirements apply)18.23 $1,553.00 Comm Dev Land Use Nonconforming Use - Extension or Continuation (nonconforming determination)18.69 $725.00 Comm Dev Land Use Nonconforming Use - Remodeling a nonconforming use 18.69.050 $725.00 Comm Dev Land Use Nonconforming Use - Bi-annual monitoring / Inspection 18.69 $155.00 Comm Dev Land Use Pre-application review (fee will be credited towards next permit application fee)20.05.020 $275.00 Comm Dev Land Use Right of Way Vacation 12.44.020 $311.00 Comm Dev Land Use Appraisal for ROW Vacation (3rd Party Appraisal)12.44.030 Actual Cost w/$1,500 Deposit Comm Dev Land Use SHORELINE DEVELOPMENT APPLICATIONS: Comm Dev Land Use Shoreline Master Plan Amendment 18.10.060 $2,070 Comm Dev Land Use Shoreline Management Base Fee 18.10.060 $166 Comm Dev Land Use Shoreline Substantial Development Permit 18.10.060 $326 Comm Dev Land Use Shoreline Conditional Use Permit 18.10.060 $326 Comm Dev Land Use Shoreline Exemption - no additional fee required 18.10.060 0 Comm Dev Land Use Shoreline Variance 18.10.060 $673 Comm Dev Land Use SUBDIVISION / PLATTING RELATED APPLICATIONS: Comm Dev Land Use Binding Site Plan 17.18 $880 plus $52 per lot Comm Dev Land Use Boundary Line Adjustment / Lot Consolidation 17.42 $362 Comm Dev Land Use Expiration of subdivision (Major or Short) / Extension of Time 17.12.100 $155 Comm Dev Land Use Subdivision Application - Preliminary Short Subdivision (1-9 lots)17.09 $870 plus $52 per lot Comm Dev Land Use Subdivision Application - Final Short Subdivision 17.09 $217 Comm Dev Land Use Subdivision Application - Preliminary Major Subdivision (10+ lots)17.12 $1770 plus $52 per lot Comm Dev Land Use Subdivision Application - Final Major Subdivision 17.12 $435 Comm Dev Land Use Planned Development District Application - Preliminary 18.67 $1770 plus $52 per lot Comm Dev Land Use Planned Development District Application - Final 18.67 $435 Comm Dev Land Use Plat Alteration 17.09 & 17.12 $1,087 COML Council Packet 11-14-23, Page 274 of 277 3 AB C DE DEPART FEE TYPE FEE DESCRIPTION MLMC Section 2024 Fee 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 Comm Dev Land Use Reconsideration of quasi-judicial decisions 18.80.140 & 20.09.070 $259 Comm Dev Land Use Revisions to approved Permits (50% of original fee)50% of original fee Comm Dev Land Use Unmentioned Uses 18.51.020 $207 Comm Dev Land Use Vacation Rental 18.63 $383 Comm Dev Land Use Vacation Rental Annual Renewal 18.63 $109 Comm Dev Land Use Variance 17 & 18 $673 Comm Dev Land Use Waivers, Deferrals, Deviations (per)17.33 $207 Comm Dev Land Use Zone Change 18.81.010 $1,087 Comm Dev Land Use Zoning Verification Letter 18.03 $75 Comm Dev Development Engineering Engineering Plan Review - by City Staff 18.10.030 $414 (for first 4 pages), $104 for each add'l sheet Comm Dev Building Permit Building Permit - Per Foot Valuation 16.02.070 Per IBC Schedule Comm Dev Building Permit Build on Unplatted Property 16.02.040 $311 Comm Dev Building Permit After Hours Inspection (2 hr. Minimum)16.02 $78 Comm Dev Building Permit Demo Permit 16.08 $217 Comm Dev Building Permit Fence Permit 12.28 $35 Comm Dev Building Permit Fence Permit (7' High or Higher)12.28 $65 Comm Dev Building Permit Grading, Parking Lots and/or Stormwater permits 18.54.100 $109 Comm Dev Building Permit Mechanical Permit 16.02 $52.00 + $11 Per Unit Comm Dev Building Permit Mobile Home Placement 18.6 $362 Comm Dev Building Permit Plumbing Permit 16.02 $52.00 + $11 Per Unit Comm Dev Building Permit Sign Permit 18.58 Per IBC Schedule Comm Dev Building Permit Solar Install 16.02 $129 Comm Dev Building Permit Storage Container Placement (per container)18.76 $105 Comm Dev Building Permit Technical Fee on all building permits Via Ordinance 1.00% Codes Description Garbage Tags 8.08.140 $3.34 GB005 Residential 1st 96 Gallon Cart 8.08.140 $37.12 GB006 Residential 1st 64 Gallon Cart 8.08.140 $24.75 GB007 Residential 1st 48 Gallon Cart 8.08.140 $22.68 GB015 Senior 1st 96 Gallon Cart 8.08.140 $18.57 GB016 Senior 1st 64 Gallon Cart 8.08.140 $12.38 GB017 Senior 1st 48 Gallon Cart 8.08.140 $11.34 GB025 Delivery 2nd Cart 8.08.140 $7.32 GB030 Cart Removal/Exchange 8.08.140 $14.67 GB150 (2)Commercial 48 Gallon Cart 1 Time a Week 8.08.140 $15.08 GB151 (2)Commercial 48 Gallon Cart 2 Times a Week 8.08.140 $23.64 GB155 Commercial 64 Gallon Cart 1 Time a Week 8.08.140 $22.31 GB160 Commercial 64 Gallon Cart 2 Times a Week 8.08.140 $36.73 GB165 Commercial 96 Gallon Cart 1 Time a Week 8.08.140 $29.53 GB170 Commercial 96 Gallon Cart 2 Times a Week 8.08.140 $51.43 GB175 Commercial 96 Gallon Cart Extra Pickup 8.08.140 $15.13 GB200 1 Yard Dumpster 1 Time a Week 8.08.140 $47.73 GB210 1 Yard Dumpster 2 Times a Week 8.08.140 $84.45 GB215 1 Yard Dumpster 3 Times a Week 8.08.140 $119.76 GB218 1 Yard Dumpster 5 Times a Week 8.08.140 $159.09 GB220 Extra Pickup 1 Yard Dumpster 8.08.140 $60.60 GB225 1.5 Yard Dumpster 1 Time a Week 8.08.140 $65.32 GB230 1.5 Yard Dumpster 2 Times a Week 8.08.140 $114.51 GB235 1.5 Yard Dumpster 3 Times a Week 8.08.140 $163.91 GB240 Extra Pickup 1.5 Yard Dumpster 8.08.140 $61.78 GB245 2 Yard Dumpster 1 Time a Week 8.08.140 $78.57 GB250 2 Yard Dumpster 2 Times a Week 8.08.140 $137.52 GB255 2 Yard Dumpster 3 Times a Week 8.08.140 $196.89 GB260 2 Yard Dumpster 4 Times a Week 8.08.140 $256.81 GB265 2 Yard Dumpster 5 Times a Week 8.08.140 $318.73 GB270 Extra Pickup 2 Yard Dumpster 8.08.140 $63.04 GB275 3 Yard Dumpster 1 Time a Week 8.08.140 $108.85 GB280 3 Yard Dumpster 2 Times a Week 8.08.140 $190.75 GB285 3 Yard Dumpster 3 Times a Week 8.08.140 $273.22 GB287 3 Yard Dumpster 4 Times a Week 8.08.140 $359.21 City of Moses Lake-Solid Waste Rates Schedule A COML Council Packet 11-14-23, Page 275 of 277 3 AB C DE DEPART FEE TYPE FEE DESCRIPTION MLMC Section 2024 Fee 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 GB288 3 Yard Dumpster 5 Times a Week 8.08.140 $452.78 GB290 Extra Pickup 3 Yard Dumpster 8.08.140 $88.59 GB295 4 Yard Dumpster 1 Time a Week 8.08.140 $135.38 GB300 4 Yard Dumpster 2 Times a Week 8.08.140 $262.07 GB310 4 Yard Dumpster 3 Times a Week 8.08.140 $372.06 GB315 4 Yard Dumpster 4 Times a Week 8.08.140 $484.56 GB320 4 Yard Dumpster 5 Times a Week 8.08.140 $601.48 GB325 Extra Pickup 4 Yard Dumpster 8.08.140 $110.10 GB330 6 Yard Dumpster 1 Time a Week 8.08.140 $187.15 GB335 6 Yard Dumpster 2 Times a Week 8.08.140 $357.05 GB340 6 Yard Dumpster 3 Times a Week 8.08.140 $525.50 GB345 6 Yard Dumpster 4 Times a Week 8.08.140 $692.52 GB350 6 Yard Dumpster 5 Times a Week 8.08.140 $858.08 GB352 Extra Pickup 6 Yard Dumpster 8.08.140 $125.23 GB355 8 Yard Dumpster 1 Time a Week 8.08.140 $256.27 GB360 8 Yard Dumpster 2 Times a Week 8.08.140 $482.31 GB365 8 Yard Dumpster 3 Times a Week 8.08.140 $705.46 GB370 8 Yard Dumpster 4 Times a Week 8.08.140 $921.41 GB375 8 Yard Dumpster 5 Times a Week 8.08.140 $1,130.17 GB380 Extra Pickup 8 Yard Dumpster 8.08.140 $151.17 GB390 Extra 1/2 Yard 8.08.140 $8.61 GB395 Extra Bag, Box or Bundle 8.08.140 $4.00 GB405 Temporary Delivery 2-8 yard 8.08.140 $28.78 GB420 Temporary 2 Yard Dumpster 8.08.140 $35.99 GB425 Temporary 2 Yard Dumpster Rental 8.08.140 $6.12 GB440 Temporary 4 Yard Dumpster 8.08.140 $57.59 GB445 Temporary 4 Yard Dumpster Rental 8.08.140 $9.78 GB460 Temporary 6 Yard Dumpster 8.08.140 $79.20 GB465 Temporary 6 Yard Dumpster Rental 8.08.140 $12.41 GB480 Temporary 8 Yard Dumpster 8.08.140 $101.38 GB485 Temporary 8 Yard Dumpster Rental 8.08.140 $15.00 GB505 10 Yard Roll-off 1 Time a Month 8.08.140 $439.12 GB510 10 Yard Roll-off Extra Pickup 8.08.140 $323.93 GB515 10 Yard Roll-off 1 Time a Week 8.08.140 $1,000.58 GB520 20 Yard Roll-off 1 Time a Month 8.08.140 $527.49 GB525 20 Yard Roll-off Extra Pickup 8.08.140 $376.46 GB530 20 Yard Roll-off 1 Time a Week 8.08.140 $1,150.83 GB535 20 Yard Roll-off 2 Times a Month 8.08.140 $749.70 GB540 30 Yard Roll-off 1 Time a Month 8.08.140 $634.54 GB545 30 Yard Roll-off Extra Pickup 8.08.140 $442.38 GB550 30 Yard Roll-off 1 Time a Week 8.08.140 $1,518.74 GB555 30 Yard Roll-off 2 Times a Week 8.08.140 $2,934.37 GB560 30 Yard Roll-off 2 Times a Month 8.08.140 $964.57 GB565 40 Yard Roll-off 1 Time a Month 8.08.140 $932.86 GB570 40 Yard Roll-off Extra Pickup 8.08.140 $505.08 GB575 40 Yard Roll-off 1 Time a Week 8.08.140 $1,707.45 GB577 40 Yard Roll-off 2 Times a Week 8.08.140 $3,414.81 GB580 Temporary Delivery 10-40 yd 8.08.140 $58.05 GB585 Temporary Rent 8.08.140 $43.53 GB595 2 Yard Compactor 1 Time a Week 8.08.140 $173.50 GB600 2 Yard Compactor Extra Pickup 8.08.140 $88.59 GB605 10 to 15 Yard Compactor 1 Time a Week 8.08.140 $1,209.08 GB610 10 to 15 Yard Compactor 1 Time a Month 8.08.140 $385.93 GB615 10 to 15 Yard Compactor 2 Times a Month 8.08.140 $699.63 GB620 10 to 15 Yard Compactor Extra Pickup 8.08.140 $360.53 GB625 16 to 20 Yard Compactor 1 Time a Week 8.08.140 $1,747.22 GB630 16 to 20 Yard Compactor 1 Time a Month 8.08.140 $481.03 GB635 16 to 20 Yard Compactor Extra Pickup 8.08.140 $442.10 GB640 21 to 30 Yard Compactor 1 Time a Month 8.08.140 $563.54 GB645 21 to 30 Yard Compactor Extra Pickup 8.08.140 $468.89 GB650 21 to 30 Yard Turn Around 1 Time a Month 8.08.140 $622.60 GB655 21 to 30 Yard Turn Around Extra Pickup 8.08.140 $527.96 GB660 31 to 40 Yard Compactor 1 Time a Month 8.08.140 $719.84 GB665 31 to 40 Yard Compactor Extra Pickup 8.08.140 $489.50 GB670 30 Cans Downtown 8.08.140 $207.32 GB680 Garbage Comm 21-30Yd Comp 1xWk 8.08.140 $2,370.91 GB685 Garbage Comm 21-30Yd Comp 2xWk 8.08.140 $4,741.85 COML Council Packet 11-14-23, Page 276 of 277 3 AB C DE DEPART FEE TYPE FEE DESCRIPTION MLMC Section 2024 Fee 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 GB710 15 Minutes Manpower 8.08.140 $21.34 GB720 15 Minutes Truck 8.08.140 $28.18 GB730 Return Trip 8.08.140 $13.34 GB900 REC Garb Haul 25 Yd 8.08.140 $254.18 GB910 REC Garb 25 Yd Single Swap 8.08.140 $74.39 GB920 REC Garb 25 Yd Double Swap 8.08.140 $111.60 GB940 REC Garb Overtime to Contractor 8.08.140 $39.74 RGB005 96 Gallon Cart replacement 8.08.140 $71.34 RGB006 64 Gallon Cart replacement 8.08.140 $64.65 RGB007 48 Gallon Cart replacement 8.08.140 $61.31 RGBLID Cart Lid replacement 8.08.140 $22.29 Nonconforming services will be billed at the nearest higher rate shown in the above schedule for the type of service rendered. Commercial accounts may pick any combination or quantity of services shown in the above and be billed on one account. Yardage or landfill charge - special service amount charged at landfill multiplied by 1.50. (1) Bill Code eliminated. Just use applic (2) Eliminating commercial can service- Replacing with commercial 48 gallo COML Council Packet 11-14-23, Page 277 of 277